[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>BAF53453.1 cglu2 BAF53453.1 "hypothetical protein"
MAHGCAHSLTFRYPSRAYPPRKLYHGYDTQWRYPLSVWRLCAHEPGRFLFVS
//