[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF53516.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- --3---25469--4----------------------------------------------------------------------------------5-------------------------------------------------1-----------------------------------------------------1-1--------------5-------8-------2-------------------8-----------------------C3-------------------------------------2234------------------------------------------------------------------------------2221222122----6--5------1--3---1----------------1----------1-1---------------------------------6---1------------------11-1-------------------------3---------------------1---------------------------------------------------------------------------------------------------------------------1-2------29---2---4------D1-----------9--3--3---A------------------------1------------------------------3-3-3---------2------------------------1--5--------------4-------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------6--------------------------1---------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRPTSGSATGGATSDLAITAGGQTLDFYLSPKRNVAAAKRFLAKTLRSNTITGSPRVINT:Sequence : :Sec Str : ============================================:BL:SWS|17->77|Y4551_YERPS|5e-10|44.3|61/107 : $$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|16->42|PF03050|6e-04|51.9|27/160|Transposase_25 61: . . . * . .: 120 :DKAPSLTRAIAELKSEGICPQTVEHWQVKYLNNVIEGDHGRLKRILGPKVAFKNLDICIS:Sequence : cEEEEEEEEEEEcccHHHHHHHTcTTTTcccHHHHHH:Sec Str :================= :BL:SWS|17->77|Y4551_YERPS|5e-10|44.3|61/107 121: . . + . . .: 180 :DVERDGGDALDSRKGQGTMFALTGNRTRTR :Sequence :HHHHTTcEEEEEETTEEEEEEEE :Sec Str