[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF53610.1"

            "hypothetical protein"
RS5_CORGL   "RecName: Full=30S ribosomal protein S5;"

OrgPattern -----1-----------------1--------111--1------1---1-111--------------- 1111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111-11111111111111111111111111111111 ------1-----111----------------------------------------------------------1------------------------------1--1------------------------------------------------------------------11112P322211143-21--11111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPGRERRDGGRSADDNKQNDRNERRGGGRRDDRRNQQQDERSQYIERVVTINRVSKVVKG:Sequence : ETTEEEEEEEEEEEccccc:Sec Str : XXXXXXXXXXXXXXXXXXXXXXXX :SEG|18->41|qndrnerrgggrrddrrnqqqder : ===============:RP:SCP|46->111|1fjgE2|3e-11|37.9|66/69|d.50.1.2 :============================================================:BL:SWS|1->211|RS5_CORGL|2e-89|100.0|211/211 : $$$$$$$$$$$$$$$:RP:PFM|46->109|PF00333|3e-10|54.7|64/67|Ribosomal_S5 61: . . . * . .: 120 :GRRFSFTALVIVGDGKGMVGVGYGKAKEVPAAIQKGAEEARKNFFRVPMVNGTITHPVQG:Sequence :cccEEEEEEEEEEcccccEEEEEEEEccHHHHHHHHHHHHHHccccccccTTcccccEEE:Sec Str : XXXXXXXXXXXXXXX :SEG|70->84|vivgdgkgmvgvgyg :################################# :PROS|61->93|PS00585|RIBOSOMAL_S5|PDOC00505| :=================================================== :RP:SCP|46->111|1fjgE2|3e-11|37.9|66/69|d.50.1.2 : =========:RP:SCP|112->190|1fjgE1|2e-12|51.9|79/81|d.14.1.1 :============================================================:BL:SWS|1->211|RS5_CORGL|2e-89|100.0|211/211 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|46->109|PF00333|3e-10|54.7|64/67|Ribosomal_S5 121: . . + . . .: 180 :EKAAGIVMLKPAAPGTGVIAGGAARPVLECAGIQDILSKSLGSDNAINVVHATVDGLKQL:Sequence :EETTEEEEEEEccTTcEEEccHHHHHHHHTTTccEEEEEEEEcccHHHHHHHHHHHHHHc:Sec Str :============================================================:RP:SCP|112->190|1fjgE1|2e-12|51.9|79/81|d.14.1.1 :============================================================:BL:SWS|1->211|RS5_CORGL|2e-89|100.0|211/211 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|127->190|PF03719|4e-15|68.8|64/74|Ribosomal_S5_C 181: . * . . . .: 240 :VRPEEVAARRGKTIEEVAPARILRARAGQEA :Sequence :ccHHHHHHHHHcccccc :Sec Str :========== :RP:SCP|112->190|1fjgE1|2e-12|51.9|79/81|d.14.1.1 :=============================== :BL:SWS|1->211|RS5_CORGL|2e-89|100.0|211/211 :$$$$$$$$$$ :RP:PFM|127->190|PF03719|4e-15|68.8|64/74|Ribosomal_S5_C