[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF53649.1"

            "hypothetical protein"
            ""

OrgPattern 11111-322333242124121232A3337553355324132223636756454133322331233-13 579372131131-133233-3-2235333332-1111213365612-1132332411-115411635542211112--2122635754776527111--44436448685--------------3424337735439BB8B-11848767887224464423344585587353312365324323111141254444476554646763644544464522343111211692111111111111114---1611145233133411433522323223432222422344242243231111111111111311333111232-846665666354614432314151-511524384672333-1-22312694556-----547735324645A43444442444-996B9A8957325552BD49C89A61542223767933-4444444442444A66-------------------------1-2--3222135533644447433336667233322556565433432511122324323445222432233332335554264763685767568B66555D6565565B773312-433543-3111111-2121233854423243143344233322224333243--15534------22555445665555574-66554555556543455456454343563676665655868744543666521533333333333--3-5455512124242222122222222222242222132323343444573334443556133322333343331111124224353333322233231-75558866-------12------------------1--------1132522221674 --22314-1-11357221-11213132------111-------------24333-11-1-11211----1-1--1---111-111112-14122311111221434-4C35224322322123354242CB4-3432311312321433132142323434548322223F45629557*CA924OINR1TJ7A97879 -----------------------2---------------------------------------------------------------------------------------------------------------------------------------------------1---

Master   AminoSeq   


1: . . . . + .: 60 :MRCVITGGAGFLGSHLTDLILNQGHEVIVLDDLSTGSLSNLFHQISNPRLQIKTVDVRKK:Sequence :cEEEEETTTcHHHHHHHHHHTTcTTEEEEccccccGGGTGGGTccTTTccTTcHHHHHHH:Sec Str : ===========================================================:RP:SCP|2->307|1sb8A|6e-62|23.3|301/341|c.2.1.2 : ===========================================================:BL:SWS|2->304|UXS1_RAT|4e-86|52.5|301/420 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->237|PF01370|1e-26|37.1|221/232|Epimerase 61: . . . * . .: 120 :FEIDGPVDIVFNLASPASPPVYTQRRVECLLINSEAVLQVAEFALEKGARLVQASTSEVY:Sequence :HHHHcccEEEEcccccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHTTcEEEEEccGGGc:Sec Str :============================================================:RP:SCP|2->307|1sb8A|6e-62|23.3|301/341|c.2.1.2 :============================================================:BL:SWS|2->304|UXS1_RAT|4e-86|52.5|301/420 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->237|PF01370|1e-26|37.1|221/232|Epimerase 121: . . + . . .: 180 :GDPLSHPQLEHHWGNVNPIGERSCYDEGKRFAEALLSAMRLEQGLNAGIIRIFNTYGPRM:Sequence :cTTccccccGGGTTcccccGGGHHHHHHHHHHHHHHHHHHHHHccEEEEEEEcEEEcTTc:Sec Str :============================================================:RP:SCP|2->307|1sb8A|6e-62|23.3|301/341|c.2.1.2 :============================================================:BL:SWS|2->304|UXS1_RAT|4e-86|52.5|301/420 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->237|PF01370|1e-26|37.1|221/232|Epimerase 181: . * . . . .: 240 :HPFDGRVISGFVRQALANEPLTVFGDGSQTRSFCYVSDLVRGLWLMGNSNQPGPINLGNP:Sequence :cccTTcHHHHHHHHHHTccEEEEEcccccEEcEEEHHHHHHHHHHHHccHHHHHHTccTT:Sec Str :============================================================:RP:SCP|2->307|1sb8A|6e-62|23.3|301/341|c.2.1.2 :============================================================:BL:SWS|2->304|UXS1_RAT|4e-86|52.5|301/420 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|4->237|PF01370|1e-26|37.1|221/232|Epimerase 241: + . . . . *: 300 :IEQTVLSMAHLIKESTNSESSITFEPLPSDDPVRRRPDISKAKELLGWEPLVGIDVGLRE:Sequence :cccEHHHHHHHHHHHHTcccEEEEETTccccccccccccHHHHHHTTccccccHHHHHHH:Sec Str :============================================================:RP:SCP|2->307|1sb8A|6e-62|23.3|301/341|c.2.1.2 :============================================================:BL:SWS|2->304|UXS1_RAT|4e-86|52.5|301/420 301: . . . . + .: 360 :VINWQIETQRTYAEKIS :Sequence :HHHHHHHTcHHHcHTTc :Sec Str :======= :RP:SCP|2->307|1sb8A|6e-62|23.3|301/341|c.2.1.2 :==== :BL:SWS|2->304|UXS1_RAT|4e-86|52.5|301/420