[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF53730.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -------1111--------------------------111--------------------11--211111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MVMGPTHAMSGAAVGLAVAQILPAEWGGVTTATEAFIYAGLAAGAALLPDLDSPQATVSR:Sequence : :Sec Str : XXXXXXXXXX :SEG|39->48|aglaagaall 61: . . . * . .: 120 :SFGPITQVISRFTENICQTFVNVTRGRKDKHCNNGHRTLTHTVWSAAATGAGATALIGTY:Sequence : :Sec Str : XXXXXXXXXX :SEG|106->115|aaatgagata 121: . . + . . .: 180 :GKPAVIGLLFFFLGLAIRGLMPEWSKNADWLLVTGASAALAVGVWNYAPESSFGIVLGSA:Sequence : HHHHHHHHHHHHHHHTTTcccEEEEETTTTH:Sec Str : XXXXXXXXX :SEG|127->135|gllffflgl 181: . * . . . .: 240 :ITVGSLTHLAGDMATKAGIPAFAPVIPLKGKRWWNLKLPKFLSIRANGPADKFLLFVFSV:Sequence :HHHHHHHHHTTcccEEEEEEEcccEEEE :Sec Str 241: + . . . . *: 300 :AVIIQIGLVSSGNMSTIMMNLLSPAL :Sequence : :Sec Str