[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF53734.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -----11111111111111-111111111111111111111----11-1---111111-------11----11111111-11-------------------11-------111111111111111---------------------1111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--11111111111111111111111111111111111-111111111111111111-111-1111111111111111111111111111111111-11111111111-111111111111111-1-1----------------------11-----------------------------1111111111111111111111111111111111111111111111111111111111111111111111111111111--11111111111111111111----11-111-11111111-1-------1111111111111111111111111111111111111--111-1------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111----------1----1------1----1111---------------111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111116111-12--2-11------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPEHPLHVIFDNPVIPPNTGNAIRMCAGTGAHLHLVEPLGFELTEKHLRRAGLDYHDLAD:Sequence : EcTcEEEEEccccHHHHHHHHHHHHHHTcEEEEEccccccccHHHHHHTTccHHHHHT:Sec Str : ==========================================================:RP:SCP|3->155|1v2xA|3e-32|27.7|148/192|c.116.1.1 : =======================================================:BL:SWS|6->157|Y766_HAEIN|2e-35|46.1|152/160 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|5->145|PF00588|4e-08|32.4|139/143|SpoU_methylase 61: . . . * . .: 120 :VTVHATFDEAMAAVPGRVFAFTTTANTRFTDIAFEPGDALLFGTEPTGLPQEHVEHSRIT:Sequence :cEEEccHHHHHHHHcGGEEEEccTTcEEGGGccccTTcEEEEEcTTTcccHHHHTTccGG:Sec Str : XXXXXXXXXXXXXXX :SEG|79->93|faftttantrftdia :============================================================:RP:SCP|3->155|1v2xA|3e-32|27.7|148/192|c.116.1.1 :============================================================:BL:SWS|6->157|Y766_HAEIN|2e-35|46.1|152/160 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|5->145|PF00588|4e-08|32.4|139/143|SpoU_methylase 121: . . + . . .: 180 :SELRIPMLPGRRSMNLSNSAAVATYEAWRQLGFVGGV :Sequence :GEEEcccccccccccHHHHHHHHHHHHHHHTTTTTcc :Sec Str :=================================== :RP:SCP|3->155|1v2xA|3e-32|27.7|148/192|c.116.1.1 :===================================== :BL:SWS|6->157|Y766_HAEIN|2e-35|46.1|152/160 :$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|5->145|PF00588|4e-08|32.4|139/143|SpoU_methylase