[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF53744.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ----------1--------------1------------11------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1-----------1------1----1-111111111--------------------------------------------1-1-1---11-----1111------111--1-----------1--------------------------------------------------------------------------------------------1------------------------------------------------------------------------1-2------------------------------------------------------------11---------------------1-----11111111-1111----------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLKDPVVIEKMIQAFESSEGELETRLMGAMLAGLNAGGEAGPVHSAGIAVARSSGWAETD:Sequence : XXXXXXXXXXXXXXXX :SEG|26->41|lmgamlaglnaggeag : ===========================================================:RP:SCP|2->90|2imhA1|9e-07|24.4|82/225|d.153.1.7 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->73|PF06267|5e-06|34.3|67/189|DUF1028 61: . . . * . .: 120 :LRIDWSDQPIEDLSKLLQEWLIQRDDYVIRGIDPSKSPAYGVPGDE :Sequence :============================== :RP:SCP|2->90|2imhA1|9e-07|24.4|82/225|d.153.1.7 :$$$$$$$$$$$$$ :RP:PFM|7->73|PF06267|5e-06|34.3|67/189|DUF1028