[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF53786.1"

            "hypothetical protein"
PRPD1_CORGL  "RecName: Full=2-methylcitrate dehydratase 1;         EC=4.2.1.79;"

OrgPattern 11----1111111111-11111---------------------------------------111---- -1---1-13321-111111-1---11111111-----1-11111111--11-211111--11--------------------1--------------------------------------------------------------1---------------------------------------------1-1111111111111111-11111111---11---------1---------------------------------------------------------------------------------------------------------------------------------------------------------------1-1----------------------11----------------------1-------111111111-----11-----------------------------1------11111111111222211122222-2212--1-----1----------1111--1------------1---1------------------1-1----------------------1--------------11--1--1-11----------------------1111------1---1--1111111111-11-1111111111-1-111-----11-1111111111111111-------------------------1111111111-1111----------------------11---11111111-1111-----------------1----------11--------------------------------------------------------------------1-- ----111--------111112211311111111111111111111112111111111111111--11-1-11---111-11--------1211111----111----------1----1----------------2----1-1----1--1---------------------------1----------1--------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRIHDVYTHLSADNFPKAEHLAWKISELATDPVEVTPDVSEMIINRIIDNAAVSAASVLR:Sequence : HHHHHHHHHTcTTc:Sec Str : ===========================================:RP:SCP|18->470|1szqA|7e-74|22.2|437/473|e.44.1.1 :============================================================:BL:SWS|1->498|PRPD1_CORGL|0.0|99.4|498/498 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|19->461|PF03972|7e-40|33.7|419/436|MmgE_PrpD 61: . . . * . .: 120 :RPVTVARQQAQSHPREKGGKVFGISGSYSPEWAAFANGVAVRELDFHDTFLAAEYSHPGD:Sequence :HHHHHHHHHHHHHTccccEEcTTcccEEcHHHHHHHHHHHHHHTcccccccccccccGGG:Sec Str :============================================================:RP:SCP|18->470|1szqA|7e-74|22.2|437/473|e.44.1.1 :============================================================:BL:SWS|1->498|PRPD1_CORGL|0.0|99.4|498/498 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|19->461|PF03972|7e-40|33.7|419/436|MmgE_PrpD 121: . . + . . .: 180 :NIPPLLAVAQAQRSSGRDLIRGIATAYEVQVELVKGICLHEHKIDHVAHLGPSAAAGLGT:Sequence :GHHHHHHHHHHHHTTcccccHHHHHHHHHHHHHTTTcccGGGTccTHH HHHHHHHHHHH:Sec Str :============================================================:RP:SCP|18->470|1szqA|7e-74|22.2|437/473|e.44.1.1 :============================================================:BL:SWS|1->498|PRPD1_CORGL|0.0|99.4|498/498 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|19->461|PF03972|7e-40|33.7|419/436|MmgE_PrpD 181: . * . . . .: 240 :LLHVDEETIYQAIGQALHTTTATRQSRKGEISSWKAFAPAFAGKMAIEAMDRAMRGEGSP:Sequence :HTTccHHHHHHHHccccc GGGcTTcccTHHHHHHHHHHHHHHHHH HHTTcccT:Sec Str :============================================================:RP:SCP|18->470|1szqA|7e-74|22.2|437/473|e.44.1.1 :============================================================:BL:SWS|1->498|PRPD1_CORGL|0.0|99.4|498/498 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|19->461|PF03972|7e-40|33.7|419/436|MmgE_PrpD 241: + . . . . *: 300 :APIWEGEDGVIAWLLSGKDHVYHVPLPEHGEPKLGILETYTKEHSAEYQSQAPIDLARRM:Sequence :cTTT cHHHHHcTTcccccccccccHHHHcc ccccccccTTTHHHHHHHHHH:Sec Str :============================================================:RP:SCP|18->470|1szqA|7e-74|22.2|437/473|e.44.1.1 :============================================================:BL:SWS|1->498|PRPD1_CORGL|0.0|99.4|498/498 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|19->461|PF03972|7e-40|33.7|419/436|MmgE_PrpD 301: . . . . + .: 360 :KPLVDAAGGTEHIAEIVLRTSHHTHYVIGTGANDPQKMDPQASRETLDHSIMYIFAVALQ:Sequence :HH HHTTccGGEEEEEEEEcHHHHHHH ccccccccHHHHTTcHHHHHHHHHH:Sec Str : ########### :PROS|306->316|PS00626|RCC1_2|PDOC00544| :============================================================:RP:SCP|18->470|1szqA|7e-74|22.2|437/473|e.44.1.1 :============================================================:BL:SWS|1->498|PRPD1_CORGL|0.0|99.4|498/498 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|19->461|PF03972|7e-40|33.7|419/436|MmgE_PrpD 361: . . . * . .: 420 :DGVWHHEFSYTRKRSTRPETVELWHKIRTVEDPEWTRRYHSDDPAKKAFGAKAVITMADG:Sequence :ccccGGGGcHHHHTcHHHHH HHHTEEEEEcHHHHHHHH cTTTccccEEEEEEETTc:Sec Str :============================================================:RP:SCP|18->470|1szqA|7e-74|22.2|437/473|e.44.1.1 :============================================================:BL:SWS|1->498|PRPD1_CORGL|0.0|99.4|498/498 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|19->461|PF03972|7e-40|33.7|419/436|MmgE_PrpD 421: . . + . . .: 480 :TLIEDELAVADAHPLGARPFARENYIEKFRTLAQGIVIDSEQERFLHAVQSLPDLDDLDQ:Sequence :ccccc EEEcccTT :Sec Str : XXXXXXXXX:SEG|472->481|lpdlddldql :================================================== :RP:SCP|18->470|1szqA|7e-74|22.2|437/473|e.44.1.1 :============================================================:BL:SWS|1->498|PRPD1_CORGL|0.0|99.4|498/498 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|19->461|PF03972|7e-40|33.7|419/436|MmgE_PrpD 481: . * . . . .: 540 :LNIEVDISNQAATKAGLL :Sequence : :Sec Str :X :SEG|472->481|lpdlddldql :================== :BL:SWS|1->498|PRPD1_CORGL|0.0|99.4|498/498