[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>BAF53786.1 cglu2 BAF53786.1 "hypothetical protein"
MRIHDVYTHLSADNFPKAEHLAWKISELATDPVEVTPDVSEMIINRIIDNAAVSAASVLR
RPVTVARQQAQSHPREKGGKVFGISGSYSPEWAAFANGVAVRELDFHDTFLAAEYSHPGD
NIPPLLAVAQAQRSSGRDLIRGIATAYEVQVELVKGICLHEHKIDHVAHLGPSAAAGLGT
LLHVDEETIYQAIGQALHTTTATRQSRKGEISSWKAFAPAFAGKMAIEAMDRAMRGEGSP
APIWEGEDGVIAWLLSGKDHVYHVPLPEHGEPKLGILETYTKEHSAEYQSQAPIDLARRM
KPLVDAAGGTEHIAEIVLRTSHHTHYVIGTGANDPQKMDPQASRETLDHSIMYIFAVALQ
DGVWHHEFSYTRKRSTRPETVELWHKIRTVEDPEWTRRYHSDDPAKKAFGAKAVITMADG
TLIEDELAVADAHPLGARPFARENYIEKFRTLAQGIVIDSEQERFLHAVQSLPDLDDLDQ
LNIEVDISNQAATKAGLL
//