[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF53863.1"

            "hypothetical protein"
            ""

OrgPattern ------------------------------------------------1------------------- ----1111111111--------------------------1---11111---111111--11111111111----------------------1----------------------------------------------1-------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----11-----------------------------------1---1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MCHLKNFPQNLIDTVTSSGLISSQLQSSVMQEKPEMPAIEVIRSAKRTKTVQARIVDGQI:Sequence : XXXXXXXXXXXX :SEG|17->28|ssglissqlqss 61: . . . * . .: 120 :QVRIPARMSKAEEEKAVGEIVAKLKRRTRSAVSSDADLIERAHKLNKTVLEGRARVESIR:Sequence 121: . . + . . .: 180 :WVSNQKGRWGSCTVATAEIRISDRLKHVPDYVLDAVLVHELTHTFIAGHSAEFWEWADKT:Sequence : ########## :PROS|156->165|PS00142|ZINC_PROTEASE|PDOC00129| : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|122->174|PF01863|1e-08|50.0|52/198|DUF45 181: . * . . . .: 240 :PLAERAKGYLEAYQRWG :Sequence