[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>BAF53863.1 cglu2 BAF53863.1 "hypothetical protein"
MCHLKNFPQNLIDTVTSSGLISSQLQSSVMQEKPEMPAIEVIRSAKRTKTVQARIVDGQI
QVRIPARMSKAEEEKAVGEIVAKLKRRTRSAVSSDADLIERAHKLNKTVLEGRARVESIR
WVSNQKGRWGSCTVATAEIRISDRLKHVPDYVLDAVLVHELTHTFIAGHSAEFWEWADKT
PLAERAKGYLEAYQRWG
//