[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF53909.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -----111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MASRKTKRKNLIQILSLIVAVLLVVILSVVFQQWWNNRPEPLPQEISISASSPAGEIEVF:Sequence : HHcTTcEEEEE:Sec Str : XXXXXXXXXXXXXXXXXXXX :SEG|11->30|liqilslivavllvvilsvv : ==================:BL:SWS|43->160|Y899_MYCBO|1e-06|32.4|111/162 : $$$$$$$$$$$$$$$$$$:RP:PFM|43->172|PF10969|3e-20|48.0|125/162|DUF2771 61: . . . * . .: 120 :PFSMCEPGVECEENEVPTLEVGADEELHLTIPEAIHDHDWYLLTIYDDPAANDEFYHTSY:Sequence :EccTTcccTTTHHHHHHHHTTcccEEEEEGGccccccTTEEEEEEcccccccEEEEEccc:Sec Str :============================================================:BL:SWS|43->160|Y899_MYCBO|1e-06|32.4|111/162 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|43->172|PF10969|3e-20|48.0|125/162|DUF2771 121: . . + . . .: 180 :DATEATVPGSVDPTEEGAERPRLVVVEVSAVMIGEDENGEESPYTVTWSLSTMNE :Sequence :cccTTccTTcEEEcccHHHcTTcEE :Sec Str :======================================== :BL:SWS|43->160|Y899_MYCBO|1e-06|32.4|111/162 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|43->172|PF10969|3e-20|48.0|125/162|DUF2771