[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF53930.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ------1-231---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLQSPKRAIGLSAALLTLTACGANDELSSYLTSIETATAQVSLNDIYNDQWSEFAVVCPY:Sequence : ===========================================:BL:SWS|18->78|FB35_ARATH|9e-04|29.5|61/100 61: . . . * . .: 120 :TPSDYAKAELDVGDTPWPDKWPDEQTNFLLLKSDTGEYKWVRYRRSNLDFCSEPRIDFTL:Sequence :================== :BL:SWS|18->78|FB35_ARATH|9e-04|29.5|61/100 121: . . + . . .: 180 :FPTAATLEFTANDGWILESVHP :Sequence