[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>BAF53930.1 cglu2 BAF53930.1 "hypothetical protein"
MLQSPKRAIGLSAALLTLTACGANDELSSYLTSIETATAQVSLNDIYNDQWSEFAVVCPY
TPSDYAKAELDVGDTPWPDKWPDEQTNFLLLKSDTGEYKWVRYRRSNLDFCSEPRIDFTL
FPTAATLEFTANDGWILESVHP
//