[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF53991.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------1 -------1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---111-------------------------------------------------------1------------------------------------------------11--11---------------11---------------------11----1--1--------------111-------------------------------------------------------------------------1-----------------1---1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSSLDNAPLLELDVQEWVNHEGLSNEDLRGKVVVVEVFQMLCPGCVNHGVPQAQKIHRMI:Sequence :ccccccccccEEEcTEcTTccEEEGGGGTTcEEEEEEEcTTcHHHHHHHHHHHHHHHHHH:Sec Str : ===================================:RP:SCP|26->139|2cv4A1|1e-11|15.0|113/150|c.47.1.10 :============================================================:BL:SWS|1->142|DIPZ_MYCTU|6e-09|29.3|133/695 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|5->133|PF08534|9e-06|30.4|112/132|Redoxin 61: . . . * . .: 120 :DESQVQVIGLHSVFEHHDVMTPEALKVFISEFGIKFPVAVDMPREGQRIPSTMKKYRLEG:Sequence :GGGTEEEEEEEEccccTTTccHHHHHHHHHHTTccccEEEcTTcHHHHHcHHHHHTTccc:Sec Str :============================================================:RP:SCP|26->139|2cv4A1|1e-11|15.0|113/150|c.47.1.10 :============================================================:BL:SWS|1->142|DIPZ_MYCTU|6e-09|29.3|133/695 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|5->133|PF08534|9e-06|30.4|112/132|Redoxin 121: . . + . . .: 180 :TPSIILADRKGRIRQVQFGQVDDFVLGLLLGSLLSETDET :Sequence :ccEEEEEcTTccEEEEEcccccccH :Sec Str : XXXXXXXXXX :SEG|146->155|lglllgslls :=================== :RP:SCP|26->139|2cv4A1|1e-11|15.0|113/150|c.47.1.10 :====================== :BL:SWS|1->142|DIPZ_MYCTU|6e-09|29.3|133/695 :$$$$$$$$$$$$$ :RP:PFM|5->133|PF08534|9e-06|30.4|112/132|Redoxin