[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>BAF53991.1 cglu2 BAF53991.1 "hypothetical protein"
MSSLDNAPLLELDVQEWVNHEGLSNEDLRGKVVVVEVFQMLCPGCVNHGVPQAQKIHRMI
DESQVQVIGLHSVFEHHDVMTPEALKVFISEFGIKFPVAVDMPREGQRIPSTMKKYRLEG
TPSIILADRKGRIRQVQFGQVDDFVLGLLLGSLLSETDET
//