[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF54034.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ----------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSFPNLKYSIKGSTDSSGRMKRLALIGSSLIISMGLITACGSANAEPETPTPTVTETVTS:Sequence : XXXXXXXXXXXXXXX :SEG|23->37|laligssliismgli : XXXXXXXXXXXXXXXX:SEG|45->81|aepetptptvtetvtstktttvkastitttvtetapa 61: . . . * . .: 120 :TKTTTVKASTITTTVTETAPAEDLGQEAVEPAAVEEYSEPQVNVPQQFAAIPDPAPAVAP:Sequence :XXXXXXXXXXXXXXXXXXXXX :SEG|45->81|aepetptptvtetvtstktttvkastitttvtetapa : XXXXXXXXXXXX:SEG|109->145|aaipdpapavapapapapayyancaaaraagaapiya 121: . . + . . .: 180 :APAPAPAYYANCAAARAAGAAPIYAGSPGYSSKLDRDGDGIACE :Sequence :XXXXXXXXXXXXXXXXXXXXXXXXX :SEG|109->145|aaipdpapavapapapapayyancaaaraagaapiya : $$$$$$$$$$$$$$$$$$$ :RP:PFM|146->164|PF05901|4e-04|84.2|19/37|Excalibur