[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF54079.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------1-----------------------1 -1--3--2222---1---------------------31-1--32-111------------22----12341-------------------------1---------1--1-----------------------1----------1------------------------1-------------1-----------------------------1------12-11-------1----------------------1--------1111--1-----------------------------------------------------1--------------------------1---------------------------1--------11------11----------1-11111211121-2---1-123121-------2--------------------------------------------------------1-1111------------111--------11-----------------11-111-------------111--------------------------------2--------------------------------11--1-------------------------1-----------------------------------------------------------------------------------------------1----------11--111------------11111-1-----------------------------------------1--------------------------------------1-------------------------------------- ----11-------1--1---111212-----------111111---1-131113--1----------1-------111-1-------1-1--1---1-1----1------1-----------------------------------------------------1---------1-------------------111-- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSKIAIITGSTRPGRVNIDVANWVLERAQERNDAQYELVDIADFNFPVLDEAMPAGYGQY:Sequence :ccEEEEEEcccccHHHHHHHHHHHHHHHHTcTTcEEEEEEccccccHHHHHHHTcccccc:Sec Str :============================================================:RP:SCP|1->187|2fzvA1|7e-23|15.6|179/233|c.23.5.4 : ==========================================================:BL:SWS|3->135|FMNR_SCHPO|3e-24|43.6|133/200 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->133|PF03358|3e-09|35.4|127/149|FMN_red 61: . . . * . .: 120 :ANEHTKAWAAKIAEFDGFIFVTGEYNHSVPAALTNALSYLSAEWNNKAAGIVSYGSAMGV:Sequence :ccccccccGGGGGGccEEEEEEEccTTcccHHHHHHHTTcHHHHTTcEEEEEEEEcccTH:Sec Str :============================================================:RP:SCP|1->187|2fzvA1|7e-23|15.6|179/233|c.23.5.4 :============================================================:BL:SWS|3->135|FMNR_SCHPO|3e-24|43.6|133/200 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->133|PF03358|3e-09|35.4|127/149|FMN_red 121: . . + . . .: 180 :RAAEHLRGILSELQIAHVQKTGLLSIFTDFEYPNFKPSEQGISSVDAMLEQLVVWTKAMS:Sequence :HHHHHHHHHHHHTTcEEcccGGGGccccTTccEEEcccHHHHHHHHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|1->187|2fzvA1|7e-23|15.6|179/233|c.23.5.4 :=============== :BL:SWS|3->135|FMNR_SCHPO|3e-24|43.6|133/200 :$$$$$$$$$$$$$ :RP:PFM|3->133|PF03358|3e-09|35.4|127/149|FMN_red 181: . * . . . .: 240 :TIRESANV :Sequence : :Sec Str :======= :RP:SCP|1->187|2fzvA1|7e-23|15.6|179/233|c.23.5.4