[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF54082.1"

            "hypothetical protein"
            ""

OrgPattern ------3133333241-------1---------111--1----11-12--1----1-----2------ 332--12366631335422-21--5722222211115CA811214297244144521611-13125759612111444--4-11---22231-1-------4-215-412-----------------1---111--2221----22--1--------------------11--------------1----141BAAA9878A28A879963AA9B8971134532333332GH45556555545555476768235-77163-3776645523226532111-----1-------------------------------1------44---1------21331222---1------451--1---1----------6--1-11-14-63211-11111--11-111115-1141121229--74436519766753-11-311111--133333333334421-2--------------------------------21253226ADFCFD76666BB97676866E879886-1776-243341215334--1-241-1---------213-2-1---11111-13-311121122-24--221---12121-121111111--11-11321211-3-23121121224222--11211-------------58242D66887667777-67577787877796767748D9592726555555555656555A65577772-322222222222----1-1111111--136111-21-22-1---24434427112816745777A277882999--1111-1--1--2-----113--78443442223------111111-------------------------------------11---1111111- -------------126432236385633253344151------1--33235444--2--1111-1-------1-3-2--1-111-1-1--1-413-11113--433------------------------------------------------------------1-1-A---1---1--------112-1------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSEYNASASKSTKLILTALALGVFGVGVTEFVPVGLLPQIANTFDTSIATTGWVISSYAA:Sequence : ========================================================:RP:SCP|5->356|1pw4A|3e-11|14.0|351/434|f.38.1.1 : =============================================:BL:SWS|16->338|YDHP_ECOLI|3e-67|40.6|323/389 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|19->272|PF07690|7e-18|29.9|254/347|MFS_1 61: . . . * . .: 120 :GVMVGAPIMTLLSIRRPRKQMLIILMVLFIIGNLLSAVAPNFALLIIGRIVTSFTHGAFF:Sequence :============================================================:RP:SCP|5->356|1pw4A|3e-11|14.0|351/434|f.38.1.1 :============================================================:BL:SWS|16->338|YDHP_ECOLI|3e-67|40.6|323/389 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|19->272|PF07690|7e-18|29.9|254/347|MFS_1 121: . . + . . .: 180 :GIGTVVAAELAGPGQRGAAVAYMFSGISLANLIGVPIGTWIGTMANWRTTFLVIAALGIL:Sequence :============================================================:RP:SCP|5->356|1pw4A|3e-11|14.0|351/434|f.38.1.1 :============================================================:BL:SWS|16->338|YDHP_ECOLI|3e-67|40.6|323/389 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|19->272|PF07690|7e-18|29.9|254/347|MFS_1 181: . * . . . .: 240 :TAVAIAYLVPNLPSPKNVRVGREIKALTHPQVILALLMTLFGFGGVFAALTYLTPIMTDI:Sequence :============================================================:RP:SCP|5->356|1pw4A|3e-11|14.0|351/434|f.38.1.1 :============================================================:BL:SWS|16->338|YDHP_ECOLI|3e-67|40.6|323/389 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|19->272|PF07690|7e-18|29.9|254/347|MFS_1 241: + . . . . *: 300 :AGYAESSMSWILIIVGVGMFTGNWTGGKLADRSLIPSVLAMLFLLAATLFAFNFTAHSAI:Sequence : XXXXXXXXXXXXXXXXXX :SEG|279->296|lamlfllaatlfafnfta :============================================================:RP:SCP|5->356|1pw4A|3e-11|14.0|351/434|f.38.1.1 :============================================================:BL:SWS|16->338|YDHP_ECOLI|3e-67|40.6|323/389 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|19->272|PF07690|7e-18|29.9|254/347|MFS_1 301: . . . . + .: 360 :LSLITIFFIGFFGMATVAPLQSVVLEYAKGAPTLASSINIGVFNLGNAVAAWLAGATITT:Sequence :======================================================== :RP:SCP|5->356|1pw4A|3e-11|14.0|351/434|f.38.1.1 :====================================== :BL:SWS|16->338|YDHP_ECOLI|3e-67|40.6|323/389 361: . . . * . .: 420 :SLGLTSAGLVGGLMTSLGLVLAIVAVVLRRKAQETRTTISVVEQQPAA :Sequence : XXXXXXXXXXXX :SEG|377->388|lglvlaivavvl