[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF54084.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ----11111111-111111-11111111111111111111----111111111111-1-----11111----111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1111-111111----------------------------11111111----------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTNPDIVGSGQGNDSFEPVAQLSYERARDELVEIVKILELGQMGLDESLKYWERGEALAK:Sequence : HHHHHHHHHHHHHH HTccccHHHHHHHHHHHHHHHH:Sec Str : =========================================:RP:SCP|20->81|1vp7A|5e-10|30.6|62/68|a.7.13.1 : ========================================================:BL:SWS|5->79|EX7S_CORDI|2e-29|73.3|75/85 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|24->75|PF02609|3e-04|48.1|52/53|Exonuc_VII_S 61: . . . * . .: 120 :RCEEHLAGASARVEQALNQAE :Sequence :HHHHHHHHHHHHHH :Sec Str :===================== :RP:SCP|20->81|1vp7A|5e-10|30.6|62/68|a.7.13.1 :=================== :BL:SWS|5->79|EX7S_CORDI|2e-29|73.3|75/85 :$$$$$$$$$$$$$$$ :RP:PFM|24->75|PF02609|3e-04|48.1|52/53|Exonuc_VII_S