[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF54198.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -----111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSLGCSTLPTMIKHRNRLMSSIYSATRYAAHFKSVFPTALDDIQSMMRHPRSLARAIPTW:Sequence : ===================================:BL:SWS|26->100|ALLS_ECOUT|3e-04|41.3|63/308 61: . . . * . .: 120 :RPPSIPLPSLPGEDPLTLTLSRHRAGPAARQIIREFGEQREPAYLITIRITSPEGFKVST:Sequence :======================================== :BL:SWS|26->100|ALLS_ECOUT|3e-04|41.3|63/308 121: . . + . . .: 180 :RLAEGWIRAVLSTAHSGTVHQLTDEPAPTFCWLVDAHFDPVRSPSFLFEYSKSAA :Sequence