[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>BAF54198.1 cglu2 BAF54198.1 "hypothetical protein"
MSLGCSTLPTMIKHRNRLMSSIYSATRYAAHFKSVFPTALDDIQSMMRHPRSLARAIPTW
RPPSIPLPSLPGEDPLTLTLSRHRAGPAARQIIREFGEQREPAYLITIRITSPEGFKVST
RLAEGWIRAVLSTAHSGTVHQLTDEPAPTFCWLVDAHFDPVRSPSFLFEYSKSAA
//