[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF54269.1"

            "hypothetical protein"
ATPG_CORGB  "RecName: Full=ATP synthase gamma chain;AltName: Full=ATP synthase F1 sector gamma subunit;AltName: Full=F-ATPase gamma subunit;"

OrgPattern -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111--1--1-111111111--------------11111111111111111111111111111111111111111111111111111111111-----11-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111111111111111111111111111111-1--122111111111111--11-11111111111111111111111111111111111111-1111111111111111111111111-11111111111111111111111111111--1--------11111111111111111-11-11111111122121111111111111111121111111111111111111111111111111111111111111111111111111111111111122111111111111111111111111111111111111111111111111111111111111111111-1111111-11111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111121211111111111111111111111111---------------1-111-111111111-1111111-1111111-11 -----------------------------------------------1-----------------------------------------1------------------5----------------------------------------------------------------1-1112J111113123-212121112 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MATIRELRDRIRSVNSTKKITKAQELIATSRITKAQGRVAAAAPYAEEIQRVLERLASAS:Sequence : ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHTcc:Sec Str : ===========================================================:RP:SCP|2->318|1e79G|7e-54|19.9|261/263|c.49.2.1 :============================================================:BL:SWS|1->325|ATPG_CORGB|e-167|100.0|325/325 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->318|PF00231|3e-55|44.3|287/289|ATP-synt 61: . . . * . .: 120 :SLDHPMLREREGGKRAAVLVVTSDRGMAGGYNHNVLKKAAELEKLLAESGYEVVRYVTGK:Sequence :cccTTTTccccccccccEEEEcccccccTTHHHHHHHHHHHHHHcccTHcccccEEEEcH:Sec Str : XXXXXXXXXXXXX :SEG|96->108|lkkaaelekllae :============================================================:RP:SCP|2->318|1e79G|7e-54|19.9|261/263|c.49.2.1 :============================================================:BL:SWS|1->325|ATPG_CORGB|e-167|100.0|325/325 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->318|PF00231|3e-55|44.3|287/289|ATP-synt 121: . . + . . .: 180 :KGVDYYKFRAEDVAGAWTGFSQDPDWAATHNVRRHLIDGFTASSEGEAAWREGLNLSEGQ:Sequence :HHHHHccGGGcTcEEEcccccccccHHHHHHHHHHHHTcccccccccHHHccccccHTTc:Sec Str :============================================================:RP:SCP|2->318|1e79G|7e-54|19.9|261/263|c.49.2.1 :============================================================:BL:SWS|1->325|ATPG_CORGB|e-167|100.0|325/325 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->318|PF00231|3e-55|44.3|287/289|ATP-synt 181: . * . . . .: 240 :DIQGFDQVHVVYTEFISMLTQNPVVHQLLPVEPVIEDEIFEKGEDLLSSSGDVEPDYEFE:Sequence :cccEcccEEEEEEEEEETTEEEEEEEEETTcTTTTccGHHHHccccccTTccccGGGccc:Sec Str :============================================================:RP:SCP|2->318|1e79G|7e-54|19.9|261/263|c.49.2.1 :============================================================:BL:SWS|1->325|ATPG_CORGB|e-167|100.0|325/325 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->318|PF00231|3e-55|44.3|287/289|ATP-synt 241: + . . . . *: 300 :PDADTLLEALLPQYVSRRLFSIFLEAAAAESASRRNAMKSATDNASELVKDLSRVANQAR:Sequence :cccTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH:Sec Str : XXXXXXXXXXX :SEG|265->275|eaaaaesasrr :============================================================:RP:SCP|2->318|1e79G|7e-54|19.9|261/263|c.49.2.1 :============================================================:BL:SWS|1->325|ATPG_CORGB|e-167|100.0|325/325 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->318|PF00231|3e-55|44.3|287/289|ATP-synt 301: . . . . + .: 360 :QAQITQEITEIVGGAGALADSGESD :Sequence :HHHHHHHHHHHHHHHHHc :Sec Str : ############## :PROS|304->317|PS00153|ATPASE_GAMMA|PDOC00138| :================== :RP:SCP|2->318|1e79G|7e-54|19.9|261/263|c.49.2.1 :========================= :BL:SWS|1->325|ATPG_CORGB|e-167|100.0|325/325 :$$$$$$$$$$$$$$$$$$ :RP:PFM|3->318|PF00231|3e-55|44.3|287/289|ATP-synt