[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF54313.1"

            "hypothetical protein"
RBSD_CORGB  "RecName: Full=D-ribose pyranase;         EC=5.5.1.n1;"

OrgPattern -------------------------------------------------------------------- --------111----------------------------------------------------1----11------------1-----------------------------------------------------1------------------------------------------------------11111111111111111111111-111-11-111-------11-----------------11111-11-1---1111-11-1--11-1111-1-1------------------------------------1------------1-1----1----1-1----1--------1--111-1----1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----------------------1-------------------------------------------------12-------1-------1------1------------------11111-1111111111-11111111111111-11-111111-111111111111111111111-1111--111111111111------------------1111---11111111----------------1111-1111-111----------11111111111111---------------------------------------------------------------1-------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKKSGLLNPDLCYAIARLGHTDTWAVADCGLPIPEHVEIIDLALVFGIPTFEQVLNALKP:Sequence :ccccccccHHHHHHHHHccTTcEEEEEcTTccccTTcEEEEccccTTcccHHHHHHHHEE:Sec Str :============================================================:RP:SCP|1->123|1ogcA|7e-12|35.0|123/131|c.133.1.1 :============================================================:BL:SWS|1->123|RBSD_CORGB|2e-50|100.0|123/123 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->121|PF05025|3e-15|41.9|117/135|RbsD_FucU 61: . . . * . .: 120 :EVVVEGAVIAEGTPERIREMVDTDVEVVTHEELKAQLAECAFVIRTGETTAYANVIFKSG:Sequence :EEETHHHHHcHHHHHHHHHTcccEEEEEcHHHHHHHHTTccEEEEcccccTTccEEEEEc:Sec Str :XXXXXXXXXXXX :SEG|61->72|evvvegaviaeg : XXXXXXXXXXXXXX :SEG|79->92|emvdtdvevvthee :============================================================:RP:SCP|1->123|1ogcA|7e-12|35.0|123/131|c.133.1.1 :============================================================:BL:SWS|1->123|RBSD_CORGB|2e-50|100.0|123/123 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->121|PF05025|3e-15|41.9|117/135|RbsD_FucU 121: . . + . . .: 180 :VAF :Sequence :ccc :Sec Str :=== :RP:SCP|1->123|1ogcA|7e-12|35.0|123/131|c.133.1.1 :=== :BL:SWS|1->123|RBSD_CORGB|2e-50|100.0|123/123 :$ :RP:PFM|1->121|PF05025|3e-15|41.9|117/135|RbsD_FucU