[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF54336.1"

            "hypothetical protein"
            ""

OrgPattern --------------------------------11-------------11--111-------------- -------1111---1----------1----------1------------------1-------------------------------1------------------1------------------1---1--------------11136466544561-----3445652-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------1---------1-111-----12333-1121-43------------44244-5112--2223223222124421-22-----2--11111111----22---------------------------------111------1222211111111111111-11131122-21111211121321211-1212-------------11-24------------11--1---------1-1---1-----------------------1-11111-2-------------------------2--------1111-11------------------------------12111-------------------1----------------------------------12112-----------1---11111-1---1222222112222212111---------3---------11-11---1111---------------------------------------------------------------1-- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTHTLFDSRRFLQLGAFASLSTALAGAARYVTSTSNNEPADNTPLTIGYVPIACSAPIAI:Sequence : HHHHHccHHccccHHHHHHTTccHHHHHHHHHHHHHTTcE:Sec Str : ===============================:RP:SCP|30->335|1dioA|3e-26|11.1|297/551|c.1.19.3 : =================================:BL:SWS|28->334|CMPC_SYNP6|1e-35|34.0|300/663 61: . . . * . .: 120 :ANALGLFKKHGVNVTLKKYSGWSDLWTAYATEQLDVAHMLSPMTVAINAGVTNASRPMEL:Sequence :EEEEccTTHHHHTTccTTccHHHHHHHHTccEEEcccGGGTTTGGGcTTHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|30->335|1dioA|3e-26|11.1|297/551|c.1.19.3 :============================================================:BL:SWS|28->334|CMPC_SYNP6|1e-35|34.0|300/663 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|69->257|PF09084|3e-07|30.2|179/200|NMT1 121: . . + . . .: 180 :SFTQNTNGQAITLASKHYGSVNSAADLKGMVLGIPFEYSVHALLLRDYLASNAVDPIADL:Sequence :HHTTcEEEccccccccccHHHHHHHHHHHHTTccccccEEEEcccGGGcTTccccccGGG:Sec Str :============================================================:RP:SCP|30->335|1dioA|3e-26|11.1|297/551|c.1.19.3 :============================================================:BL:SWS|28->334|CMPC_SYNP6|1e-35|34.0|300/663 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|69->257|PF09084|3e-07|30.2|179/200|NMT1 181: . * . . . .: 240 :KLRLLPPADMVAQLTVEGIAGFIGPEPFNERAISNGSGRIWLLTKQVWDKHPCCAVAKAK:Sequence :HHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHTTcccccHHHHHcTTHHHHcccGG:Sec Str :============================================================:RP:SCP|30->335|1dioA|3e-26|11.1|297/551|c.1.19.3 :============================================================:BL:SWS|28->334|CMPC_SYNP6|1e-35|34.0|300/663 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|69->257|PF09084|3e-07|30.2|179/200|NMT1 241: + . . . . *: 300 :EWKAEHPTAAQGVLNALEEVSAILSNPAQFDSSARTLSQEKYLNQPAALLDGPFSGMYQD:Sequence :GcccccHHHHHHHHHHHHHTTccHHcHTTEHHHHHHHHHTTcHHHHHHHHHHHHHcGGGc:Sec Str :============================================================:RP:SCP|30->335|1dioA|3e-26|11.1|297/551|c.1.19.3 :============================================================:BL:SWS|28->334|CMPC_SYNP6|1e-35|34.0|300/663 :$$$$$$$$$$$$$$$$$ :RP:PFM|69->257|PF09084|3e-07|30.2|179/200|NMT1 301: . . . . + .: 360 :WHGQTHTDHERMSFGDPTDPTAIIWMATQIARWGLGGDVLTMDDSTIINAAQSVLTPGLS:Sequence :TTcEEETTTEEEcTcccccccTTccccccHHHHHH :Sec Str :=================================== :RP:SCP|30->335|1dioA|3e-26|11.1|297/551|c.1.19.3 :================================== :BL:SWS|28->334|CMPC_SYNP6|1e-35|34.0|300/663 361: . . . * . .: 420 :VTGEHLNIISADFAPVTPTSGYEHMDSVIFR :Sequence : :Sec Str