[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF54367.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -2---11-1111--1------1--1-------1---------------1--------------1-------11111112--1----------------------------111111111111111---------1-----------2322222--111111111223---2111111111111---------1-111111111111111-111-1111--1-111--------1--------------------1--11-----11--11-1----1111111222222111111111111111111111111222111221212-13-------2-2-11122121--11-22--11-----1-----1-12--1----------111111111111------------11111111-1--111111111111--1---1111111----------1---1111-------------------------------1---------------------12--------1111------1-----1-11---21211----------------221--11-22----2121213-211111122-------------------------111121-1--1-111111-1-111111-11-----1--1------22222212222222222-22222222222222222222332211-222222222222222222222222--211122212222-------------2----222232-11112111----------1-11111111111111111111111111111111111111111----------------2-11------------1-1-------------------------1--11-----11- --11222----11111111111111111111111111111-11111-111111111111111111111111111111111111111---1-1111111111--2-2-1--26444333222133443637R3-5361323333431333332-33423313A21141211312211223i333125234123------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPASDVSEQISTAGKEASGTSNMKFMMNGALTLGTMDGANVEIVDSVGEENAYIFGARVE:Sequence :cTTccEEEEcccTTccccccHHHHHHHTTcEEEEEccTHHHHHHHHHcGGGcEEEcccHH:Sec Str : ############# :PROS|16->28|PS00102|PHOSPHORYLASE|PDOC00095| :============================================================:RP:SCP|1->181|1a8iA|3e-47|48.3|174/813|c.87.1.4 :============================================================:BL:SWS|1->180|PYGM_BOVIN|8e-45|50.9|173/842 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->73|PF00343|2e-23|65.8|73/455|Phosphorylase 61: . . . * . .: 120 :ELPALRESYQPYELYETVPGLKRALDALDNGTLNDNNSGLFYDLKHSLIHGYGKDASDTY:Sequence :HHHHHTTcccHHHHHHHcHHHHHHHHHHHTTcccTTcTTTTHHHHHHHHHcTcGGcccTT:Sec Str :============================================================:RP:SCP|1->181|1a8iA|3e-47|48.3|174/813|c.87.1.4 :============================================================:BL:SWS|1->180|PYGM_BOVIN|8e-45|50.9|173/842 :$$$$$$$$$$$$$ :RP:PFM|1->73|PF00343|2e-23|65.8|73/455|Phosphorylase 121: . . + . . .: 180 :YVLGDFADYRETRDRMAADYASDPLGWARMAWINICESGRFSSDRTIRDYATEIWKLKPT:Sequence :cHHHHHHHHHHHHHHHHHHHTHcHHHHHHHHHHHHHTcGGGcHHHHHHHHHHHTTccccc:Sec Str :============================================================:RP:SCP|1->181|1a8iA|3e-47|48.3|174/813|c.87.1.4 :============================================================:BL:SWS|1->180|PYGM_BOVIN|8e-45|50.9|173/842 181: . * . . . .: 240 :PAVKK :Sequence :cccc :Sec Str := :RP:SCP|1->181|1a8iA|3e-47|48.3|174/813|c.87.1.4