[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF54487.1"

            "hypothetical protein"
ZUPT_CORGL  "RecName: Full=Zinc transporter zupT;"

OrgPattern ----1-----------1-------1112-111--1---111-1-----1-211-1---1-----1--- -----1-1111-----------------------------------1---------1---------------------1-1--1-111------------1-------1----------------1-111111--2----------1-1----11-----------1------------------1----1-1-------------------------11111111111111-----------------1111-----------------------------1----11------------------------1111--1111132--22222222212111111-11211---11111--1221-111-1---11---2-----------------------------------------------------------2----------------------------------------------------------------1-----------------------------------1-----------11------11111-------1-1-111-1111-------1---------1------1111------------1-----111----1-----------------------------------11--11-1111111111-1111111111111111111111-----111111111111111111111111-----------------1---------1--1-1111-----------------1---11----111--11111111------------------------1111111-22-------111---------1----1-------------------------111-1111-1--1 ----112-----112111111111111111111111111111111111111111--1-1111-11----11--11------11-2-11----1----------212-2912------1-1--1-------------1-1--11---11-------1-11---1--1-141311211532822221121211153EAED2 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDTSTVLFAFGLTLFAGLATGIGGLIAVSRKTVTEGFLAGSLGFSVGVMLYVSFVEILPG:Sequence : XXXXXXXXXXXXXXXXXXXXX :SEG|7->27|lfafgltlfaglatgigglia : =================================:BL:SWS|28->268|ZUPT_CORGL|e-116|99.2|241/263 61: . . . * . .: 120 :AFDELTSVWGEKGGSWAAVIGFFGGIALIAIIDRLVPTAINPHEPSTVGGAVEGFERRNR:Sequence : XXXXXXXXXXXXXXXX :SEG|77->92|aavigffggialiaii :============================================================:BL:SWS|28->268|ZUPT_CORGL|e-116|99.2|241/263 121: . . + . . .: 180 :MMKMGVLTALAIAIHNFPEGFATFLAGLSDPTIAIPVAVAIAIHNIPEGIAVAVPLREAT:Sequence : XXXXXXXXXXX :SEG|153->163|iaipvavaiai :============================================================:BL:SWS|28->268|ZUPT_CORGL|e-116|99.2|241/263 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|124->263|PF02535|2e-18|42.4|139/299|Zip 181: . * . . . .: 240 :GSRRKALGWATLSGLAEPAGALIGFLLLMPFIGPEALGLCFAAVAGVMVFISVDELLPTA:Sequence :============================================================:BL:SWS|28->268|ZUPT_CORGL|e-116|99.2|241/263 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|124->263|PF02535|2e-18|42.4|139/299|Zip 241: + . . . . *: 300 :ISSGKHHTAIYGLIAGMAVMAISLLLFI :Sequence :============================ :BL:SWS|28->268|ZUPT_CORGL|e-116|99.2|241/263 :$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|124->263|PF02535|2e-18|42.4|139/299|Zip