[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF54563.1"

            "hypothetical protein"
            ""

OrgPattern ------------------------------1------------------------------------1 --1-21-43331-132-11-13--1111111-31315414-2211111211-412-2----21-1--1211------------1--1--------------------------------------1--1------------11-----------------------------------------1----------------------------------1------------1------------------------------------------------------------------------------------------1---------------------------------1----1------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------21-----------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MIDQPSVLFVCVGNGGKSQMAAALAKKHAGDALEIHSAGTKPGTKLNQQSLESIAEVGAD:Sequence :ccccEEEEEEETTcccHHHHHHHHHHHHcTTTEEEEEEEcccTccccHHHHHHHHHTTcc:Sec Str : XXXXXXXXXXXXX :SEG|21->33|aaalakkhagdal : ==========================================================:RP:SCP|3->134|1jf8A|3e-18|26.6|128/130|c.44.1.1 : ===========================================================:BL:SWS|2->130|ARSC1_STAHJ|4e-10|32.0|125/133 61: . . . * . .: 120 :MSQGFPKGIDLDLIRRVDRVIILGAEAQLEMPINANGTLQRWLTDEPSERGIEGMERMRL:Sequence :cTTcccccccHHHHHHccEEEEccHHHHHTccccTTccEEEccccccTTccHHHHHHHHH:Sec Str :============================================================:RP:SCP|3->134|1jf8A|3e-18|26.6|128/130|c.44.1.1 :============================================================:BL:SWS|2->130|ARSC1_STAHJ|4e-10|32.0|125/133 121: . . + . . .: 180 :VRDDIDARVQNLIAELTQNA :Sequence :HHHHHHHHHHHHHTHH :Sec Str :============== :RP:SCP|3->134|1jf8A|3e-18|26.6|128/130|c.44.1.1 :========== :BL:SWS|2->130|ARSC1_STAHJ|4e-10|32.0|125/133