[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>BAF54563.1 cglu2 BAF54563.1 "hypothetical protein"
MIDQPSVLFVCVGNGGKSQMAAALAKKHAGDALEIHSAGTKPGTKLNQQSLESIAEVGAD
MSQGFPKGIDLDLIRRVDRVIILGAEAQLEMPINANGTLQRWLTDEPSERGIEGMERMRL
VRDDIDARVQNLIAELTQNA
//