[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF54635.1"

            "hypothetical protein"
RIBBA_CORGL  "RecName: Full=Riboflavin biosynthesis protein ribBA;Includes:  RecName: Full=3,4-dihydroxy-2-butanone 4-phosphate synthase;           Short=DHBP synthase;           EC=4.1.99.12;Includes:  RecName: Full=GTP cyclohydrolase-2;           EC=3.5.4.25;  AltName: Full=GTP cyclohydrolase II;"

OrgPattern ------------------1-1-12-----1--11111111111-21--11111--1-111-211--11 2221311111121111122-2211222222223323218711112-111111-322122222312234311----1-----12111111212-111---2121111112111111111111111111121111121222-111111111111212111111111111111111111111111111111---1111111121311112111111311111112211------1311111111111111111111--1----2---1111----111-111111-------11111111111-----------------------11-11222211311111111111-111--1111111211211111-1-11111-111111112122211111111-1111111111-11311311111112211212221122111223222222211111111211112232222222222---------------222212443222222344335344443333444424444444311222411221121112211213312222222111211122121222222221212311122332334113222222222222222222222222223342223123233333233333333333332-1111122-22222222222222222222-2222222222222222222222223322222222222222222222222222222222222232222221111111112133111132212222122233333332223222224333344442333111111111122243333354344222222222222221111111111----------1----------------1--------11-111-111111 ------1-----3323334333434343333333333333333222223332422222333332233322222322222232222222-35333333333353343-26-------------------------------------------------1----1-----------1222N2212212463333264342 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSEHEQAHSQLDSVEEAIADIAAGKAVVVVDDEDRENEGDIIFAAELATPELVAFMVRYS:Sequence : HHHHHHHHHHHHTcccEEEEccccccccccccccTTcccHHHHHHHHHHc:Sec Str : XXXXXXXXXXXXXX :SEG|27->40|vvvvddedrenegd : ====================================================:RP:SCP|9->212|1g57A|1e-76|42.4|198/205|d.115.1.2 :============================================================:BL:SWS|1->422|RIBBA_CORGL|0.0|100.0|422/422 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|14->208|PF00926|3e-54|58.5|193/194|DHBP_synthase 61: . . . * . .: 120 :SGYICAPLTAKDADRLDLPPMTAHNQDARGTAYTVTVDANTGTTGISATDRAHTLRLLAD:Sequence :ccccEEEEcHHHHHHTTccccccccTTccccccccccccTTTcccccTTHHHHHHHHHTc:Sec Str :============================================================:RP:SCP|9->212|1g57A|1e-76|42.4|198/205|d.115.1.2 :============================================================:BL:SWS|1->422|RIBBA_CORGL|0.0|100.0|422/422 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|14->208|PF00926|3e-54|58.5|193/194|DHBP_synthase 121: . . + . . .: 180 :PEADRTDFTRPGHVVPLRAREGGVLVRAGHTEAAVDLARAAGLRPAGVICEVVSEEDPTG:Sequence :ccccccccccccccEEEEcccccTTccccccHHHHHHHHTTTccccccccccccTTcccc:Sec Str :============================================================:RP:SCP|9->212|1g57A|1e-76|42.4|198/205|d.115.1.2 :============================================================:BL:SWS|1->422|RIBBA_CORGL|0.0|100.0|422/422 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|14->208|PF00926|3e-54|58.5|193/194|DHBP_synthase 181: . * . . . .: 240 :MARVPELRRFCDEHDLKLISIEQLIEWRRKNEILVERQVETVLPTDFGTFKAVGYRSIID:Sequence :cccHHHHHHHHHHHHcEEEEcHHHHHHHHHHHccEEEEEEEEEEETTEEEEEEEEEETTT:Sec Str :================================ :RP:SCP|9->212|1g57A|1e-76|42.4|198/205|d.115.1.2 : ============================:RP:SCP|213->388|2bz0A1|6e-59|49.4|168/168|c.144.1.1 :============================================================:BL:SWS|1->422|RIBBA_CORGL|0.0|100.0|422/422 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|14->208|PF00926|3e-54|58.5|193/194|DHBP_synthase : $$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|217->386|PF00925|3e-60|65.9|167/169|GTP_cyclohydro2 241: + . . . . *: 300 :GTELVAIVAGDVASDGGENVLVRVHSECLTGDVFGSRRCDCGQQLHESLRLIQEAGRGVV:Sequence :ccEEEEEEEccccccccccEEEEEEEccHHHHTcccccccHHHHHHHHHHHHHHHTcEEE:Sec Str :============================================================:RP:SCP|213->388|2bz0A1|6e-59|49.4|168/168|c.144.1.1 :============================================================:BL:SWS|1->422|RIBBA_CORGL|0.0|100.0|422/422 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|217->386|PF00925|3e-60|65.9|167/169|GTP_cyclohydro2 301: . . . . + .: 360 :VYMRGHEGRGIGLLAKLRAYQLQDEGADTVDANLALGLPADAREFGTSAQILYDLGVRSL:Sequence :EEEccTHTTTTcHHHHHHHHHHHTTcccTTcccHHTTcccccccTHHHHHHHHHTTcccE:Sec Str :============================================================:RP:SCP|213->388|2bz0A1|6e-59|49.4|168/168|c.144.1.1 :============================================================:BL:SWS|1->422|RIBBA_CORGL|0.0|100.0|422/422 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|217->386|PF00925|3e-60|65.9|167/169|GTP_cyclohydro2 361: . . . * . .: 420 :NLISNNPAKKVGLEGHGISIASRTPIPVAVHEDNVRYLKTKRDRMGHDLPDVALWEQEHP:Sequence :EEEcccHHHHHHHHHTTccEEEEEccccHHH :Sec Str :============================ :RP:SCP|213->388|2bz0A1|6e-59|49.4|168/168|c.144.1.1 :============================================================:BL:SWS|1->422|RIBBA_CORGL|0.0|100.0|422/422 :$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|217->386|PF00925|3e-60|65.9|167/169|GTP_cyclohydro2 421: . . + . . .: 480 :EN :Sequence : :Sec Str :== :BL:SWS|1->422|RIBBA_CORGL|0.0|100.0|422/422