[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF54728.1"

            "hypothetical protein"
DUT_CORGB   "RecName: Full=Deoxyuridine 5'-triphosphate nucleotidohydrolase;         Short=dUTPase;         EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;"

OrgPattern ---1---------------------------------------------------------------- 1111131111111111111-1111111111111111111111111111111112111111111111-111111111111111111---111111111--11111111-1111111111111111111111111111----------111--1-----------1--1---1-----------------1111--11111---1-11---1-----------1---1--1-111-1--1-1-21111111---------------------------332---1-----------------11111111--11-----------11-21111111111111111---11112-1111113122111-111111----111111112111111111111111111111111-111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111112111111111112111111111111111111111111111111111-1111111111111111111111111111------------111111111-11--11111-1--1--111111111111111111111-11111-1-11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111-111111111111111111--------1--------------11111111111111--11111111--------1111-1---------------1-----------------1- ----121-----111111-11111111-111111111111111111-11111111111111111111111111111111111111111-*11111222221-111111-121211-211-111122111493-21311--1-13-1-11-11-112-123421111-212311211111811111112411111-111- -------------------1----------------1----------------------------------------1----111------------------------1-11---1---1-1-----------111-----------------------1----------11--

Master   AminoSeq   


1: . . . . + .: 60 :MTDLAPIKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTV:Sequence : ccccEEEEccTTccccccccTTccEEEEEccccEEEcTTEEEEEEccEEEEccTTEE:Sec Str : ======================================================:RP:SCP|7->120|1mq7A|9e-34|69.3|114/134|b.85.4.1 :============================================================:BL:SWS|1->149|DUT_CORGB|6e-73|100.0|149/149 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|19->146|PF00692|6e-23|52.0|125/128|dUTPase 61: . . . * . .: 120 :GLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK:Sequence :EEEEccHHHHHHHcEEEEEEccEEcTTcccccEEEEEEccccccEEEcTTcEEEEEEEEE:Sec Str :============================================================:RP:SCP|7->120|1mq7A|9e-34|69.3|114/134|b.85.4.1 :============================================================:BL:SWS|1->149|DUT_CORGB|6e-73|100.0|149/149 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|19->146|PF00692|6e-23|52.0|125/128|dUTPase 121: . . + . . .: 180 :VELVDFEEVEELDDTVRGDQGYGSTGKTA :Sequence :cccccccccccccccccTTccTTTTcc :Sec Str :XXXXXXXXXXXXXX :SEG|121->134|velvdfeeveeldd :============================= :BL:SWS|1->149|DUT_CORGB|6e-73|100.0|149/149 :$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|19->146|PF00692|6e-23|52.0|125/128|dUTPase