[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF54831.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- 2332623333343333333-34223533333344445666233433411112333222111232332786411111112312311111-----------111-11---11---------------2221221112121132---142112112221111222221131132122111122111111--22123344444554354455423222245412312-122222231-1111111111111111111-11122111-111112211---------------------------------------------------2235433333333333133255523411322233343321223444211223-2111-1-11-111-------12------------11-1111---2-111--1111111-11111222122212111111112111112211----------112211111111111111121211111-2333322222222122222122211112112221111111212112222221--------212112-3212121111111123233332233225-1111111111111-1111--1-1111122--1-1-221-1111111-111112122112----112------2-11111------------------------------212----1----------------2---------111111111111----2222211112211-111111111111111------1222111111222211111-221---------1-11------2121111111111111111112111111111111-1111--------------------------11-1122111221 ------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------1------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNKVQRRSLMALCMTVAFAGGSLTACTPRPDTADPIAEEFLQAWASQDFDTIADITDQAD:Sequence : :Sec Str : ========================:RP:SCP|37->134|1mwrA1|7e-15|13.0|92/106|d.17.4.5 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|31->137|PF05223|7e-09|28.0|107/118|MecA_N 61: . . . * . .: 120 :LATEMLSTSFDGLQADSVELTLDSVDSRDTIATANFSVVWKLPRDREVSYDSSMTLTKMR:Sequence : EEEEEEc EEEET:Sec Str :============================================================:RP:SCP|37->134|1mwrA1|7e-15|13.0|92/106|d.17.4.5 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|31->137|PF05223|7e-09|28.0|107/118|MecA_N 121: . . + . . .: 180 :NEWTVRWEPSLVHPKLGANQHLELRAIEAQRANVISSDGAPVLAPGSIYRVLADPSAGDA:Sequence :TEHHHHHHHHHHHHHHcEEETTEEEcccccEEEEEcTTccEEEEccccHHHTccGGGGGG:Sec Str :============== :RP:SCP|37->134|1mwrA1|7e-15|13.0|92/106|d.17.4.5 : =========================================:RP:SCP|140->293|1rp5A3|4e-14|15.6|154/200|d.175.1.1 :$$$$$$$$$$$$$$$$$ :RP:PFM|31->137|PF05223|7e-09|28.0|107/118|MecA_N 181: . * . . . .: 240 :DVVVKRVADYLNEAHATDENVNTLDVEDIMSNLGDSTYSLTTVDANLGARMEQDLAGIPG:Sequence :ccEEEEEEEEHHHHHHTTcccTHHHHHHHHHHcTTcEEEEEEEEEEEEcTTEcccHcccc:Sec Str :============================================================:RP:SCP|140->293|1rp5A3|4e-14|15.6|154/200|d.175.1.1 241: + . . . . *: 300 :LTFNEEASMVATDPGFAPDIVSRVARIVEDELEGSNGWRASIVTSNGAVIDDIAYDAPEL:Sequence :EEEcccccEEEEccHcHHHHHHHHHHHHHHHHHHTTccTTTTccHHHHHHHHHHHHHHHH:Sec Str :===================================================== :RP:SCP|140->293|1rp5A3|4e-14|15.6|154/200|d.175.1.1 : =====================================:BL:SWS|264->592|PBP2_HAEIN|8e-20|30.7|326/651 301: . . . . + .: 360 :APSVRISLDHNVQRAAEEAVDLRAEMKAMMVVMRPSTGEILAVAQTDEADKDGDVALMGQ:Sequence :TcccEEcccHHHHHHHHHHHHcccccEEEEEEEETTTccEEEEEccccTTTcccTTTTcc:Sec Str : =====================================================:RP:SCP|308->575|1mwrA3|1e-48|25.5|259/330|e.3.1.1 :============================================================:BL:SWS|264->592|PBP2_HAEIN|8e-20|30.7|326/651 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|328->593|PF00905|2e-23|36.2|257/289|Transpeptidase 361: . . . * . .: 420 :YPPGSTFKIITAAAGLAHEGLTPDSIVPCPGTMNIYGRIVTNYNSFSLGNTSLDDAFANS:Sequence :cccGGGGHHHHTHHHHHHTTccTTcEEEccccccTTccccccTTcccccEEEHHHHHHHT:Sec Str :============================================================:RP:SCP|308->575|1mwrA3|1e-48|25.5|259/330|e.3.1.1 :============================================================:BL:SWS|264->592|PBP2_HAEIN|8e-20|30.7|326/651 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|328->593|PF00905|2e-23|36.2|257/289|Transpeptidase 421: . . + . . .: 480 :CNTTFADISTNLEPGQLKNVAKQFGLGIDYQIPGLDTMTGSVPAGDIVLDRTESGYGQGL:Sequence :ccHHHHHHHHHHHHTTccHHHHHHHTTccccccccTTHHHHTTcTTcHHcccccGGGTTT:Sec Str :============================================================:RP:SCP|308->575|1mwrA3|1e-48|25.5|259/330|e.3.1.1 :============================================================:BL:SWS|264->592|PBP2_HAEIN|8e-20|30.7|326/651 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|328->593|PF00905|2e-23|36.2|257/289|Transpeptidase 481: . * . . . .: 540 :DLASPFGMALVASTAATGSVPTPTLISGHETVASEEVPALDPEVLANVQRMMKSVVNDGT:Sequence :ccccHHHHHHHHHHHHTTTEEcccccEEEEEcccccEEcccHHHHHHHHHHHHHHHHTcc:Sec Str :============================================================:RP:SCP|308->575|1mwrA3|1e-48|25.5|259/330|e.3.1.1 :============================================================:BL:SWS|264->592|PBP2_HAEIN|8e-20|30.7|326/651 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|328->593|PF00905|2e-23|36.2|257/289|Transpeptidase 541: + . . . . *: 600 :ARGMRQTGGQIYAKTGEAEINEGSHAWFTGYREDDIAFATLVVLGGGSEAAAAVTDQFFV:Sequence :cccHHHHHHccEEEEEccTTccEEEEEEEEEcccEEEEEEEEcTTTTTTHHHHHHHHHHH:Sec Str :=================================== :RP:SCP|308->575|1mwrA3|1e-48|25.5|259/330|e.3.1.1 :==================================================== :BL:SWS|264->592|PBP2_HAEIN|8e-20|30.7|326/651 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|328->593|PF00905|2e-23|36.2|257/289|Transpeptidase 601: . . . . + .: 660 :KLDELRAGGEVAVSEAEEQPVG :Sequence :HHHccc :Sec Str : XXXXXXXXXXXX :SEG|607->618|aggevavseaee