[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF54857.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -----21-445-1-11111-11111-1111111111-743----1---11--1----1-------11--3------------1------------------------------------------------------11-----2-5-12-------------32---7-----------------------1122323333-3333332133253331213-11------93-111111111111111--11-----------------1------------------11111111111------------------------11-1----1--122-1---2121----1----1---------------1-----------1---------------------------------1------1------1-------1--------------------------------------------------------------------------------------------------------1-----------------------------------------------------1------------------------------12--1--------------------------------------1--1--11---1---1---11---1-11-1111111----2211------------------------11-111111111111---------------213----11--------111111---1----------1------122-------------1-----21211------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MQMKISRRAFLGTLLGATTLAVAACAQSSQNQNSSASSSSSSSAESSTSPSSSDEQRIVA:Sequence : TcccEEE:Sec Str : XXXXXXXXXXXXXX :SEG|11->24|lgtllgattlavaa : XXXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|26->53|aqssqnqnssasssssssaesstspsss : ======:RP:SCP|55->310|2phzA1|2e-31|20.6|248/277|c.92.2.4 : =====:BL:SWS|56->309|YFIY_BACSU|2e-23|31.4|245/325 61: . . . * . .: 120 :LNTGQLDNLLLLGITPVGVAAAKNSDLIPQFLKDRFSADMDLDSIADCGLRQSPDIEAIA:Sequence :ccHHHHHHHHHTTccccEEccTTcGGGccHHHHHHHHHccHHcccEEccccccccHHHHH:Sec Str :XXXXXXXXXXXXX :SEG|61->73|lntgqldnllllg :============================================================:RP:SCP|55->310|2phzA1|2e-31|20.6|248/277|c.92.2.4 :============================================================:BL:SWS|56->309|YFIY_BACSU|2e-23|31.4|245/325 : $$$$$$$$$$$$$$$$:RP:PFM|105->288|PF01497|3e-11|29.0|183/235|Peripla_BP_2 121: . . + . . .: 180 :NLNPTLICANSRADEEVLNKLRTIAPVVTGEGGGENWKQDLLTIAEAAGQKEKAETLLKS:Sequence :HTcccEEEEETTTTTTTHHHHHHHccEEcTTccHHHHHHHHHHHHHHTTcHHHHHHHHHH:Sec Str :============================================================:RP:SCP|55->310|2phzA1|2e-31|20.6|248/277|c.92.2.4 :============================================================:BL:SWS|56->309|YFIY_BACSU|2e-23|31.4|245/325 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|105->288|PF01497|3e-11|29.0|183/235|Peripla_BP_2 181: . * . . . .: 240 :YEDSAAEIAANQPANPPTVSFLRTKDQEFQMYGAQSMAGTVAADCGYARPENQQFTDTAG:Sequence :HHHHHHHHHHHcccTTccEEEEEEETTEEEEccTTcHHHHHHHHTTccccccHHHHHTTG:Sec Str :============================================================:RP:SCP|55->310|2phzA1|2e-31|20.6|248/277|c.92.2.4 :============================================================:BL:SWS|56->309|YFIY_BACSU|2e-23|31.4|245/325 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|105->288|PF01497|3e-11|29.0|183/235|Peripla_BP_2 241: + . . . . *: 300 :QDLSAELIAQADADWLFYGMKEGNINPEDTPLWTSLKAVQSNQAIPVDGDSWYLNASLVS:Sequence :GGEcHHHHHHHcccEEEEEEGGGccccHHcHHHHTcHHHHTTcEEEEEHHHHTTTccHHH:Sec Str :============================================================:RP:SCP|55->310|2phzA1|2e-31|20.6|248/277|c.92.2.4 :============================================================:BL:SWS|56->309|YFIY_BACSU|2e-23|31.4|245/325 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|105->288|PF01497|3e-11|29.0|183/235|Peripla_BP_2 301: . . . . + .: 360 :AEIILQGLKDNVTV :Sequence :HHHHHHHHHH :Sec Str :========== :RP:SCP|55->310|2phzA1|2e-31|20.6|248/277|c.92.2.4 :========= :BL:SWS|56->309|YFIY_BACSU|2e-23|31.4|245/325