[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>BAF54857.1 cglu2 BAF54857.1 "hypothetical protein"
MQMKISRRAFLGTLLGATTLAVAACAQSSQNQNSSASSSSSSSAESSTSPSSSDEQRIVA
LNTGQLDNLLLLGITPVGVAAAKNSDLIPQFLKDRFSADMDLDSIADCGLRQSPDIEAIA
NLNPTLICANSRADEEVLNKLRTIAPVVTGEGGGENWKQDLLTIAEAAGQKEKAETLLKS
YEDSAAEIAANQPANPPTVSFLRTKDQEFQMYGAQSMAGTVAADCGYARPENQQFTDTAG
QDLSAELIAQADADWLFYGMKEGNINPEDTPLWTSLKAVQSNQAIPVDGDSWYLNASLVS
AEIILQGLKDNVTV
//