[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF55031.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ----111111111111111-11111111111111111111------------1111-1--111-1111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPLTPADVHNVAFNKPPIGKRGYNEDEVDQFLDLVEDALVQFQEENEDLKQQVEELEAQV:Sequence :============================================================:BL:SWS|1->360|AG84_MYCTU|1e-37|46.1|243/260 61: . . . * . .: 120 :AGGTSSAASSSTAGAATAAASKSVDEAALRKEIEEKLRSEYASKLDDASKAAQKAQNDAK:Sequence :XXXXXXXXXXXXXXXXXXXXX :SEG|61->81|aggtssaassstagaataaas :============================================================:BL:SWS|1->360|AG84_MYCTU|1e-37|46.1|243/260 121: . . + . . .: 180 :SAQDQLQRAQADAKAARDEAEKAKAEAKAAASSNTTKAAAVGAVGAGTGAAVATGAANVD:Sequence : XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|127->177|qraqadakaardeaekakaeakaaassnttkaaavgavgagtgaavatgaa :============================================================:BL:SWS|1->360|AG84_MYCTU|1e-37|46.1|243/260 181: . * . . . .: 240 :THMQAAKVLGLAQEMADRLTSEARSESKSMLDEAREAAEKQIEEANSTSNRTLEDARANA:Sequence :============================================================:BL:SWS|1->360|AG84_MYCTU|1e-37|46.1|243/260 241: + . . . . *: 300 :EKQIAEAQNRADTLVNEADAKAKNLISEAEKKSAATLAASTSRAEAQIRQAEDKANALQA:Sequence : XXXXXXXXXXXXXXXXXXXX :SEG|267->286|seaekksaatlaastsraea :============================================================:BL:SWS|1->360|AG84_MYCTU|1e-37|46.1|243/260 301: . . . . + .: 360 :DAERKHTETMAAVKEQQNALETRIAELQTFEREYRTRLKSLLEGQLEELNARGSSAPTNN:Sequence :============================================================:BL:SWS|1->360|AG84_MYCTU|1e-37|46.1|243/260 361: . . . * . .: 420 :KPSGE :Sequence