[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>BAF55031.1 cglu2 BAF55031.1 "hypothetical protein"
MPLTPADVHNVAFNKPPIGKRGYNEDEVDQFLDLVEDALVQFQEENEDLKQQVEELEAQV
AGGTSSAASSSTAGAATAAASKSVDEAALRKEIEEKLRSEYASKLDDASKAAQKAQNDAK
SAQDQLQRAQADAKAARDEAEKAKAEAKAAASSNTTKAAAVGAVGAGTGAAVATGAANVD
THMQAAKVLGLAQEMADRLTSEARSESKSMLDEAREAAEKQIEEANSTSNRTLEDARANA
EKQIAEAQNRADTLVNEADAKAKNLISEAEKKSAATLAASTSRAEAQIRQAEDKANALQA
DAERKHTETMAAVKEQQNALETRIAELQTFEREYRTRLKSLLEGQLEELNARGSSAPTNN
KPSGE
//