[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF55227.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111122111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111111111111111111111211111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111-1111111111111111111111111111-1111111111111111111111121111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 11--111-311-1111-11111111111111111111111111111-111111111111111111111111-111-1-1111111111-111-111111111111--13123211131-1-11123111161-112111-2-11111111111311111131-3111111A11111222Q222222112-23212111- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MDAFSAIVHRDNAQWYGNKMTVKLKELIPRQQFEVPVQAAIGSKVIARENIRALRKDVLA:Sequence :EEEEEEEEEGGGHHHHHHHHHHHHHHHcccccccEEEEEEETTEEEEEEEEccccTTccc:Sec Str : ===========================================================:RP:SCP|2->99|1g7dA|5e-13|17.4|92/106|a.71.1.1 :============================================================:BL:SWS|1->106|LEPA_CORGL|4e-56|99.1|106/615 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|1->104|PF06421|1e-34|75.0|104/109|LepA_C 61: . . . * . .: 120 :KCYGGDISRKRKLLEKQKAGKKRMKNIGSVEVPQEAFVAALSTDEA :Sequence :ccccHHHTTTcEEEEEEEcTTcccEEEHEEEEEGGGccccccc :Sec Str :======================================= :RP:SCP|2->99|1g7dA|5e-13|17.4|92/106|a.71.1.1 :============================================== :BL:SWS|1->106|LEPA_CORGL|4e-56|99.1|106/615 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|1->104|PF06421|1e-34|75.0|104/109|LepA_C