[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF55235.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ----111111111111111-11--111111111111111-1---1-1-111-1---1111111-1111111----11111111-----------------------------------------------------11111---11----11-1----------------------------------11--1111111111111111111111111111-11111111111-1--1-11111---11111-111-1-1111111111111-111-111111111111111111111111111111111-11111111111111111111111111111111111111111-1111111111111111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------211------------------1--------------1-----------------1----------------------11111----1-------------1--1-11--3----------------------------------------------------1-1----------------------------------------------------1------------------111111-----1------1--------------------------------11----------------------------------1-------------------------11-1111111--- ---------------------------------------------------------------------------------------------------------------1-111-----11-11-111311111-1113111--1-11111-1111-----1----------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRVNYPTPRFQISIKHGLIVCIILVVAFVGWFFTREKPVNPPTMAALAETYQTPAPSSQV:Sequence : :Sec Str : XXXX:SEG|57->65|ssqvvvsvv 61: . . . * . .: 120 :VVSVVGHVAKPGLVTLAEGSRVADALAIAGTLPDADLTALNLAQLLVDGTQIHVLAIGEV:Sequence : EccccTTTTTTTccTTcEEEcTTcHHHHHHHHHHTTccccHHHHHHHTTcccc:Sec Str :XXXXX :SEG|57->65|ssqvvvsvv : =====================:RP:SCP|100->195|3ci0K2|2e-18|16.7|96/110|a.60.16.1 : =======================================================:BL:SWS|66->195|COMEA_BACSU|4e-19|38.5|130/205 121: . . + . . .: 180 :QPISVDAAATSASGLISLNTATVADLVTLPGVGEKTAQAIIDFRESNGGFSTVEDLLQVK:Sequence :cGGHHHHHTTcccTHHHHHHccHHHHHHcTTccHHHHHHHHHHHHHHcccccGGGGGGcT:Sec Str :============================================================:RP:SCP|100->195|3ci0K2|2e-18|16.7|96/110|a.60.16.1 :============================================================:BL:SWS|66->195|COMEA_BACSU|4e-19|38.5|130/205 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|136->185|PF03934|2e-05|47.9|48/268|GspK 181: . * . . . .: 240 :GIGPSKFEQISGLVSP :Sequence :TccHHHHHHHHHHGGc :Sec Str :=============== :RP:SCP|100->195|3ci0K2|2e-18|16.7|96/110|a.60.16.1 :=============== :BL:SWS|66->195|COMEA_BACSU|4e-19|38.5|130/205 :$$$$$ :RP:PFM|136->185|PF03934|2e-05|47.9|48/268|GspK