[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>BAF55235.1 cglu2 BAF55235.1 "hypothetical protein"
MRVNYPTPRFQISIKHGLIVCIILVVAFVGWFFTREKPVNPPTMAALAETYQTPAPSSQV
VVSVVGHVAKPGLVTLAEGSRVADALAIAGTLPDADLTALNLAQLLVDGTQIHVLAIGEV
QPISVDAAATSASGLISLNTATVADLVTLPGVGEKTAQAIIDFRESNGGFSTVEDLLQVK
GIGPSKFEQISGLVSP
//