[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF55333.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ----41-11111--RED77-7J11IE777779HLJLICQH-1-32--1-------1-3--213-5333723-------------------------1--------1--1------------------------------12---2-1111----------------1--12------------1-1--------11111--1--11-11------1----------------------------------------------------------------------------------------------------------------------------------------------------------------4558-----1-A54---11212------------11112211-1A-1--1--1--------6111-1-11--1111111112-----1------------------------------13B41-111--3233333333355213333-39362434--43-1A-1-1-1-11----------------211-------------------------------12------------------------------1-13------------1---------------------------1---------------------------------------21------------------------------------------------1111-71-1---------------7647724-12--3324-21242---1-1-------------------------11--1-------------22--22------------------------------------------------- ----2-------112QMYGOEJFXNXT774555998ADEDBDD9998CAJHbdf9CG79767913-1--1--2-3------33261---8FBM375132151663--2D1P67753A2-332A3C9563FO6-A6743229348543341834B3326925F-94-11141333412-----1118B8EID6--1---2 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTTTEAIYKRTVIVGSGFAGLGMGAQLKRRGDHDFVIIERADDVGGTWRDNTYPGAACDV:Sequence :TccHHHHHccEEEEcccHHHHHHHHHHHHHTTccEEEEEccccccccHHHHcHHHHHHHH:Sec Str : ====================================================:RP:SCP|9->167|1i8tA1|1e-20|12.0|158/298|c.4.1.3 : ================================================:BL:SWS|13->489|Y916_MYCBO|5e-80|35.2|471/495 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|13->212|PF00743|2e-45|45.9|196/247|FMO-like 61: . . . * . .: 120 :PSHLYSFSFHPNPNWSQVFSPGPEIQTYLQNFAQDEGLLPHLHFNRNMNNARWDEKEGRW:Sequence :HHHHHHTHHHHTcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHTcEEEEccEEEEE:Sec Str :============================================================:RP:SCP|9->167|1i8tA1|1e-20|12.0|158/298|c.4.1.3 :============================================================:BL:SWS|13->489|Y916_MYCBO|5e-80|35.2|471/495 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|13->212|PF00743|2e-45|45.9|196/247|FMO-like 121: . . + . . .: 180 :HITTPGQVYIAQFLITGTGHLADESYPTIPGLESFTGEKFHSARWDHNVSLKGKRIGVVG:Sequence :TcccccEEEEccEEEEcccETTHHHEEcccTTcccccccEEcHHHHTTccccccEEEEcc:Sec Str :=============================================== :RP:SCP|9->167|1i8tA1|1e-20|12.0|158/298|c.4.1.3 : ===================================:RP:SCP|146->341|1w4xA2|2e-16|30.6|196/235|c.3.1.5 :============================================================:BL:SWS|13->489|Y916_MYCBO|5e-80|35.2|471/495 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|13->212|PF00743|2e-45|45.9|196/247|FMO-like 181: . * . . . .: 240 :TGASAIQIVPEMAKIASELVVFQRTPSYIIPRMERKYTDGEKRLFQRNPHVIENLRSELF:Sequence :ccHHHHHHHHHHHHHTcEEEEEcccccccTTccHHHHHHHHHHHHHccccEEccEEEEEE:Sec Str :============================================================:RP:SCP|146->341|1w4xA2|2e-16|30.6|196/235|c.3.1.5 :============================================================:BL:SWS|13->489|Y916_MYCBO|5e-80|35.2|471/495 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|13->212|PF00743|2e-45|45.9|196/247|FMO-like 241: + . . . . *: 300 :WGGENTFAQRRAIPRFLAEGKKLALDHLAAQVSDEELRAKLTPSYEPGCKRVLISNTYYP:Sequence :EcccccccEEEEEEETTcccEEEccccEHHHHHHHHHHHHHHccccHHEEEEEccEEEEE:Sec Str :============================================================:RP:SCP|146->341|1w4xA2|2e-16|30.6|196/235|c.3.1.5 :============================================================:BL:SWS|13->489|Y916_MYCBO|5e-80|35.2|471/495 301: . . . . + .: 360 :ALQSPITTLEASALSSINGSTVRAASGEEYELDILIFATGFEATEPPYAQLIDGCDGLNL:Sequence :EEEcTcccEEEEEEEEEEEEEEEEEEEEEEEccEEEEccccccccccTTccccTTTTcEE:Sec Str :========================================= :RP:SCP|146->341|1w4xA2|2e-16|30.6|196/235|c.3.1.5 :============================================================:BL:SWS|13->489|Y916_MYCBO|5e-80|35.2|471/495 361: . . . * . .: 420 :SEHWERGMQAYQSVAVAGFPNLLSINGPNTSLGHNSIVYIIESQIEYILGAMDYMSAIGA:Sequence :TTEETTcTTEEEcTHHHHcTTccHHHHHHHHHHHHHHHHHHTTccHTccccccccTHHHH:Sec Str :============================================================:BL:SWS|13->489|Y916_MYCBO|5e-80|35.2|471/495 421: . . + . . .: 480 :SIIEPTAEAEEAYVEHIQRNAVGTVWLDGGCNSWYVDQRTGRLTLIWPDFGYAFRDANGT:Sequence :HHHHHHHTcccccHHHHHHHHHHHHHHHTcccccccHHHHHHHcccccccHHHHHHHHHH:Sec Str :============================================================:BL:SWS|13->489|Y916_MYCBO|5e-80|35.2|471/495 481: . * . . . .: 540 :FDAEGYEFRDVPATAPATL :Sequence :HHHTTcT :Sec Str :========= :BL:SWS|13->489|Y916_MYCBO|5e-80|35.2|471/495