[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF55378.1"

            "hypothetical protein"
            ""

OrgPattern 11----1211111111-----11------11------------------------------------1 -11-52-322311156533-371168333334478769BF-5242-12---1312212--11523274352-----------4--1-1---------------1----1------------------------------------51111111--11---11-11-111111----1------11-11---12111111123223211211--2211232-22--------11-1111111121111221231--1----1---221111211--1111111-222-11-----------111-11111--11-11---111--1--11111111-1-12-------------------------1---1--12--2332-----123352123112222222221111---------113-133156622434121412212222323111111111111--11------------------------------25321111122221221111122322222111112332--11211111211112221----11--1111121221-1---------------1-----------11-1-------------------------11111132115211111112211111221111---11--------1111-111111111111-111111111111111111132212111111-1111111-1--13-1----1--111111111111---1-----1----11222222-1--111----111-3-311111112122111121111121--1-1----1222-----111111222222111--------11--11-----------------1------------------------------- ----112-----111653252434455111111111321222122221132473-1132222111131211111211-1111111111-1115111111131311--131-5647844225382784I1Gl9-B7G744342263334-226383A27C12212231113123-1111291111159IM1CB2231212 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MQTLAAIVRATKQPFEIATIDLDEPRPDEVQVRVIAAGVCHTDAIVRDQIYPTFLPAVFG:Sequence :EEEEEEEcccTTcccEEEEEEEccccTTEEEEEEEEEEccHHHHHHHHTccccccccccc:Sec Str : XXXX:SEG|57->77|avfghegagvvvavgsavtsv : #:PROS|60->74|PS00059|ADH_ZINC|PDOC00058| :============================================================:RP:SCP|1->193|1f8fA1|4e-27|31.6|187/188|b.35.1.2 :============================================================:BL:SWS|1->363|XYLB_PSEPU|6e-66|40.1|362/366 61: . . . * . .: 120 :HEGAGVVVAVGSAVTSVKPDDKVVLGFNSCGQCLKCLGGKPAYCEKFYDRNFACTRDDGS:Sequence :cEEEEEEEEEcTTcccccTTcEEEEccccccccTTTTcccccccTTccccccccccTTcc:Sec Str :XXXXXXXXXXXXXXXXX :SEG|57->77|avfghegagvvvavgsavtsv :############## :PROS|60->74|PS00059|ADH_ZINC|PDOC00058| :============================================================:RP:SCP|1->193|1f8fA1|4e-27|31.6|187/188|b.35.1.2 :============================================================:BL:SWS|1->363|XYLB_PSEPU|6e-66|40.1|362/366 121: . . + . . .: 180 :TAFSEDGEQVGSHFFGQSTFANYTNVSARSVVKVDDDVPLELLGPLGCGLSTGAGAILNS:Sequence :ccEEETTEEEccccTTTcccccEEEEEGGGEEEEcTTccHHHHGGGGTHHHHHHHHHHTT:Sec Str : XXXXXXXXXXXX :SEG|159->170|plellgplgcgl :============================================================:RP:SCP|1->193|1f8fA1|4e-27|31.6|187/188|b.35.1.2 : ==========:RP:SCP|171->330|1v3tA2|5e-18|11.9|160/182|c.2.1.1 :============================================================:BL:SWS|1->363|XYLB_PSEPU|6e-66|40.1|362/366 181: . * . . . .: 240 :LGVRAGDTVAVFGTGAVGSAAIMAAAATGATTIIAVDIHNSRLEMAKELGATHTINSKDE:Sequence :ccccTTcEEEEEcccHHHHHHHHHHHHTTccEEEEEcccGGGHHHHHHHTccEEEcGGGc:Sec Str : XXXXXXXXXXXXXXXXXXXXXX :SEG|194->215|tgavgsaaimaaaatgattiia :============= :RP:SCP|1->193|1f8fA1|4e-27|31.6|187/188|b.35.1.2 :============================================================:RP:SCP|171->330|1v3tA2|5e-18|11.9|160/182|c.2.1.1 :============================================================:BL:SWS|1->363|XYLB_PSEPU|6e-66|40.1|362/366 : $$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|216->302|PF00107|2e-12|45.3|86/128|ADH_zinc_N 241: + . . . . *: 300 :DPAEKIKQLTGDGVQFALDTTGVVAVTRQAADSLAINGTVGLVGAPAPGAEATFEVGASL:Sequence :ccHHHHHHHHTTcccEEEEccccHHHHHHHHHTccTTTcEEEEcccccTTccccccTHHH:Sec Str :============================================================:RP:SCP|171->330|1v3tA2|5e-18|11.9|160/182|c.2.1.1 :============================================================:BL:SWS|1->363|XYLB_PSEPU|6e-66|40.1|362/366 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|216->302|PF00107|2e-12|45.3|86/128|ADH_zinc_N 301: . . . . + .: 360 :VRGWKFQTIIEGDAVPQDFIPRLVHLWRQGKFPIEKLVRTYPLEHINDAFADSASGEVIK:Sequence :HTTcEEEEccGGGccHHHHHHHHHHHHHTTccccGGGEEEEEGGGHHHHHHHHHHTcccE:Sec Str :============================== :RP:SCP|171->330|1v3tA2|5e-18|11.9|160/182|c.2.1.1 :============================================================:BL:SWS|1->363|XYLB_PSEPU|6e-66|40.1|362/366 :$$ :RP:PFM|216->302|PF00107|2e-12|45.3|86/128|ADH_zinc_N 361: . . . * . .: 420 :PIITFP :Sequence :EEEEcT :Sec Str :=== :BL:SWS|1->363|XYLB_PSEPU|6e-66|40.1|362/366