[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF55431.1"

            "hypothetical protein"
CLPS_CORGL  "RecName: Full=ATP-dependent Clp protease adapter protein clpS;"

OrgPattern -------------------------------------------------------------------- ---111111111-111111-11111111111111111111111111111111111111--11-11111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSSPSAPLATPDVELDVHTLSSENLPWLCIVWDDPVNLMSYVTYVFQTVLGFSKKRATEL:Sequence : EEEEEEEccccccHHHHHHHHHHHHcccHHHHHHH:Sec Str : ===================================:RP:SCP|26->99|1lzwA|8e-19|27.0|74/91|d.45.1.2 :============================================================:BL:SWS|1->100|CLPS_CORGL|1e-55|100.0|100/100 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|30->96|PF02617|1e-09|35.8|67/76|ClpS 61: . . . * . .: 120 :MMQVHTEGKAVVSSGEKDKVEGDVKKLHTAGLWATMQQAG :Sequence :HHHHHHHcEEEEEEEcHHHHHHHHHHHTTccccEEEEE :Sec Str :======================================= :RP:SCP|26->99|1lzwA|8e-19|27.0|74/91|d.45.1.2 :======================================== :BL:SWS|1->100|CLPS_CORGL|1e-55|100.0|100/100 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|30->96|PF02617|1e-09|35.8|67/76|ClpS