[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF55454.1"

            "hypothetical protein"
            ""

OrgPattern --------------21--------------1-------------------------------11---- ---11122222-1--------1--13-----1122212121--1--1--211211-1-------1--2---------------------------------1---2--1---------------------1---1111111-----1------------------------------------11------1-122222211-212211-----1-211112121111111-2-12111121122111111111-2-11-----11--111-----------------------------------------------------11-------------1--------------------------------1--1---------112121-122332------------11111312113-2--1---1----2211-212212211111111111123--1-1-----------------------------11-----52311111112----11-2------1-31311-112113---213221--3----------------223--1-1----------1-1111-1211111---1--------------------------1-111-1-211-1111-11-11-1-11111--11312------11111111112111211-111111211112111111111222111111111111111111111111111--111111111111---1----------1111-------------------1--12-2-1121-22-1----1111----------2111111111111123--------1111--1-------------------------------------------------------- ---------------22--111-2-1---------------------2--2132----1-------1---------------1111------2----------1---1---1---------------------------------------------------1---------------------2--11----1---1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MFSEGPINSVVLTQDEDGNFSTAYQDTYSDPSFLGEGDVLIEVGWSSLNYKDAMALKGDK:Sequence : EEEEETTEEEEEEEcccccEGGGcccTTEEEEEEEEEEccTTHHHHHTTTT:Sec Str : ===========================:RP:SCP|34->130|1o89A1|3e-14|48.5|97/143|b.35.1.2 : ==================================================:BL:SWS|11->335|YHDH_ECOLI|6e-59|39.6|321/324 61: . . . * . .: 120 :GVVRTVPLIPGIDVVGTVIESADPRFGRGDEVVLNGAGLGENRHGGFTQRLKVPSEPLLH:Sequence :cTTccccEEcccEEEEEEEEEcTTccTTTcETccTTcEEEEEcccccccEEEEEGGGcEE:Sec Str :============================================================:RP:SCP|34->130|1o89A1|3e-14|48.5|97/143|b.35.1.2 :============================================================:BL:SWS|11->335|YHDH_ECOLI|6e-59|39.6|321/324 121: . . + . . .: 180 :IPFNFSAQQVGALGTAGFTAALSVNALVDQGIKPEDGEILVTGSTGGVGSIALHLLNKLG:Sequence :cccccHHHHHHHTHHHHHHHHHHHHTcccTTcEccccEEEETTTTcTTHHHHHHHHHHHT:Sec Str : XXXXXXXXXXXX :SEG|131->142|galgtagftaal :========== :RP:SCP|34->130|1o89A1|3e-14|48.5|97/143|b.35.1.2 : =====================================:RP:SCP|144->302|1o89A2|2e-27|52.9|157/177|c.2.1.1 :============================================================:BL:SWS|11->335|YHDH_ECOLI|6e-59|39.6|321/324 181: . * . . . .: 240 :YTTVAVTGRREAHAEYLTSLGASDIIDRAELSEKGRPLQKGRWAGVVDSVGSHTLVNAIA:Sequence :TcEEEEEEccHHHHHHHHHTTccEEEETTTccHHHHHHcTTcEEEEEEcccHHHHHHHHH:Sec Str :============================================================:RP:SCP|144->302|1o89A2|2e-27|52.9|157/177|c.2.1.1 :============================================================:BL:SWS|11->335|YHDH_ECOLI|6e-59|39.6|321/324 241: + . . . . *: 300 :QTKWGGIVTACGMAQGPDLPGTVLPFILRGVHLVGINSVDAPRELRRRAWALLSEHLDTA:Sequence :HEEEEEEEEEcccGGGTTccccccccccTTHHHHHHGcGGGHHHHHHHHHHHHHTTcEcc:Sec Str :============================================================:RP:SCP|144->302|1o89A2|2e-27|52.9|157/177|c.2.1.1 :============================================================:BL:SWS|11->335|YHDH_ECOLI|6e-59|39.6|321/324 301: . . . . + .: 360 :VLDDMTTVIDVKDVAQAGEDLMAGKLHGRTAVRVH :Sequence :TTcTTcccccGGGHHHHHHHHHTTccccEEEEEcT :Sec Str :== :RP:SCP|144->302|1o89A2|2e-27|52.9|157/177|c.2.1.1 :=================================== :BL:SWS|11->335|YHDH_ECOLI|6e-59|39.6|321/324