[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF55467.1"

            "hypothetical protein"
            ""

OrgPattern ---------------------------1---------------------------------------- -11-------1-----------------------------------2------2---------------1--------------------1--1-------1--22-3-1-----------------------------11--------------------------------------------------------------------21--------------111121-6-------------------1----------------------------------------------------------------------1-------------------------1----------------1111-----11--1----------------------------1----------1---11---1---11--------------------------------------------------------------13---------------------------------------------------------------------------------------------------------------------------------------1----1-------------------------------------1------------------------------------11-------------------------------------------------------------------------------------------------------------------------------11---------------------------------------------------------------------1- -------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MADIGVQMMMLKDQVAELGMYPVLEKLKELNIASVEVSQIPMNEENTAALERGISELGIE:Sequence : EEEEGGGccccHHHHcHHHHHHHHHHTTccEEEEEHHTTcTTccccHHHHHHHHHHH:Sec Str : =========================================================:RP:SCP|4->277|1xp3A1|9e-11|13.3|256/297|c.1.15.1 : ================================================:BL:SWS|13->277|IOLE_BACC3|4e-04|24.8|254/298 61: . . . * . .: 120 :VGALSVAFGPSAAPGVDSLENDFDKIVADCKRLGVKYTRIGMMPFQAMTSKEATETWAAQ:Sequence :HHHHHHHHTcETcccHHHHHHHHHHHHHHHHHHHHHTccccEEEEEcccccccHHHHHHH:Sec Str :============================================================:RP:SCP|4->277|1xp3A1|9e-11|13.3|256/297|c.1.15.1 :============================================================:BL:SWS|13->277|IOLE_BACC3|4e-04|24.8|254/298 121: . . + . . .: 180 :VEPYAARLAVEGITLCYHNHHVDLHKFGNERIFDIVRRVAPSLFFEVDLHWVQRGGMAPL:Sequence :HHHHHTTcHHHHTTEEEEcccTTcccccHHHHHHHHHHccHTccEEEEHHHHHHccHHHH:Sec Str :============================================================:RP:SCP|4->277|1xp3A1|9e-11|13.3|256/297|c.1.15.1 :============================================================:BL:SWS|13->277|IOLE_BACC3|4e-04|24.8|254/298 181: . * . . . .: 240 :DMLKEYAGVCKLIHVKDFRVTELPEEAMELFTAGDFMKGYEKFVNIVEFAEVGQGNMNWP:Sequence :HHHGGGcccccEEEEcccccTETcGGGGGGGcHHHHHcTTcccTcccccTTcccccccHH:Sec Str :============================================================:RP:SCP|4->277|1xp3A1|9e-11|13.3|256/297|c.1.15.1 :============================================================:BL:SWS|13->277|IOLE_BACC3|4e-04|24.8|254/298 241: + . . . . *: 300 :ELLPASKAAGAEYFFIEQDMTYGRDPFDCIKDSREYLTSIGW :Sequence :HHHHHHTTccccEEEEcccGGGcccHHHHHHHHHHHHHHH :Sec Str :===================================== :RP:SCP|4->277|1xp3A1|9e-11|13.3|256/297|c.1.15.1 :===================================== :BL:SWS|13->277|IOLE_BACC3|4e-04|24.8|254/298