[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>BAF55596.1 cglu2 BAF55596.1 "hypothetical protein"
MQDPELPVDKVGASTFKTQRLKRWGNCTVDCDIEDGVAEADIFSLESISGVVEFLP
//