[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF55672.1"

            "hypothetical protein"
            ""

OrgPattern --2--1----------1------------1----------------111--11-2323442--11--- 121-111222322144333-3433433333344454588712122211222243322311--2121433422222222---1111111--112211-----1-112-11----------------4543343332311111---1-1-1---1-----------1------------------121--111-11-------1-------211111---121-11111111112-11-1--1--111--111111---11-------1111----1-111--------11-----------------------------------12224444444335-122----212---512-4223211-122321-----1-111-----111---111122211111111112-11-11-1111--1112111111--1-1-1-1-1-1111-11111111---1-2-1-----------------------------121221-----1----1-------11--------1---------------1-2--11-11--11--------------342-111113111-2-21-1131433211131----11111----------1111---11-111111-11222212322222222233---1232------212122-3333333333-333333333333323333222232111222222222221212212122223--122222222222-------------1-11----1-1-----1---1111111111-111111121122221111---------1233311111231221111111111----1121--------------3---------------------------3222221211-1- 2211112-41112222222222212222212222222222222222222222221222222222222211212222212322222222-22222222222212323122141121-21-1-111111215K2-115-11111111-11--1--11111112112222523522411222T2112253322232222223 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSRPLRVAVVGAGPAGIYASDLLMKSDTDVQIDLFERMPAPFGLIRYGVAPDHPRIKGIV:Sequence :cccccEEEEEcccHHHHHHHHHHHHHccccEEEEEcccccccTHHHHTccTTcGGGGGHH:Sec Str : =======================================================:RP:SCP|6->224|1cjcA2|8e-16|23.3|219/230|c.4.1.1 : ==========================================================:BL:SWS|3->447|FPRA_MYCTU|2e-85|41.9|437/456 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->172|PF07992|3e-07|36.2|152/275|Pyr_redox_2 61: . . . * . .: 120 :KSLHNVMDKEQLRFLGNIEVGKDITVEELREFYDAIVFSTGATGDQDLRVPGSDLEGSWG:Sequence :HHHHHHHTcTTEEEEcccccTTTccHHHHHHHccEEEEccccccccccccTTTTcTTEEE:Sec Str :============================================================:RP:SCP|6->224|1cjcA2|8e-16|23.3|219/230|c.4.1.1 :============================================================:BL:SWS|3->447|FPRA_MYCTU|2e-85|41.9|437/456 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|7->172|PF07992|3e-07|36.2|152/275|Pyr_redox_2 121: . . + . . .: 180 :AGEFVGFYDGNPNFERNWDLSAEKVAVVGVGNVALDVARILAKTGDELLVTEIPDNVYES:Sequence :HHHHHHHHTTcGGGTccccccccEEEEEcccHHHHHHHHHHHccGGGGTTccccHHHHHH:Sec Str :============================================================:RP:SCP|6->224|1cjcA2|8e-16|23.3|219/230|c.4.1.1 :============================================================:BL:SWS|3->447|FPRA_MYCTU|2e-85|41.9|437/456 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|7->172|PF07992|3e-07|36.2|152/275|Pyr_redox_2 181: . * . . . .: 240 :LAKNQAKEVHVFGRRGPAQAKFTPLELKELDHSDTIEVIVNPEDIDYDAASEQARRDSKS:Sequence :HHHccccEEEEEccccGGGccccHHHHHHHHTcTTEEEEccGGGGTTcHHHHHTccHHHH:Sec Str :============================================ :RP:SCP|6->224|1cjcA2|8e-16|23.3|219/230|c.4.1.1 :============================================================:BL:SWS|3->447|FPRA_MYCTU|2e-85|41.9|437/456 241: + . . . . *: 300 :QDLVCQTLESYAMRDPKGAPHKLFIHFFESPVEILGEDGKVVGLKTERTQLDGNGGVTGT:Sequence :HHHHHHHHHHHccccHHHHHHHHTcEccEEEEEEEEcTTcccEEEEEEEEEEEEccEEEE:Sec Str : ====================================:RP:SCP|265->357|1d5tA1|7e-05|19.2|78/336|c.3.1.3 :============================================================:BL:SWS|3->447|FPRA_MYCTU|2e-85|41.9|437/456 301: . . . . + .: 360 :GEFKTWDVQSVYRAVGYRSDAIEGVPFDDERAVVPNDGGHIIDPEVGSPITGLYATGWIK:Sequence :EEEEEEEccEEEEcccccccccTTccccTTTcccTTTTcccEETTEETTcTTEEEcTHHH:Sec Str :========================================================= :RP:SCP|265->357|1d5tA1|7e-05|19.2|78/336|c.3.1.3 :============================================================:BL:SWS|3->447|FPRA_MYCTU|2e-85|41.9|437/456 361: . . . * . .: 420 :RGPIGLIGNTKSDAKETTEMLLADHAAGSLPAPAKPELESIIEFLDERKVAFTTWDGWHL:Sequence :HcTTccHHHHHHHHHHHHHHHHHHHHTTccccccccTHHHHHHHHHTTTcccccHHHHHH:Sec Str :============================================================:BL:SWS|3->447|FPRA_MYCTU|2e-85|41.9|437/456 421: . . + . . .: 480 :LDAAERALGEPEGRERKKIVEWNDMVRHARPEYDI :Sequence :HHHHHHHHHHTTTccccccccHHHHHHHHHHH :Sec Str :=========================== :BL:SWS|3->447|FPRA_MYCTU|2e-85|41.9|437/456