[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF55698.1"

            "hypothetical protein"
            ""

OrgPattern 1111121------112111111111111--11111--------21-2211222-111-11-111--11 111-311111111121111-1111141111113111238611122211111-212111--112-3215341---------1111-21111121211-----2-11212-2---------------111111--12111111---111112221112211111211221111111111111111111-----11111111111111111111111111111211--2222221211111111111111111111-------1-1-111111-1-11------------11---------------------------111-----221311111111111211------1----1211123-111-1---1---1121222-----111221112111111111111112-12111112312-111111213222211221212133311--------21111121------------------------------21212111111111321111111221111111121112-111111111111112111111112111111111111112121-1------1-22122223211111121-11211111--1-111111121111221233231133111111-1111111111121---3234------2111122-111111111-1--111111111111-1112221111111111111111-1-11111111112-111111111111---2-----211122231---------------11111111213145444454243222322-1-1--1-1-1111111111312211111111111-1---1-111111--------2----------------------------2211-----121 ----322-211-111322133324241221111111222222222233342332221-2221222122222222222-2222223223-121211122-2212221-11141523222211122522424A2-3352211222231222-21132111321222221257111611322H1112334542432121115 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRIALLQISTNSDKMDNFALLRDAAEKAAEQGARVLVFPEATSQSFGTGRLDTQAEELDG:Sequence :EEEEEEEcccTTcHHHHHHHHHHHHGGGTcTTccEEEccTTTTTccccGGGGGGcEETTc:Sec Str :============================================================:RP:SCP|1->266|1f89A|7e-46|28.9|249/271|d.160.1.1 :============================================================:BL:SWS|1->247|Y480_MYCTU|1e-48|47.4|234/340 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|17->176|PF00795|1e-07|33.6|152/171|CN_hydrolase 61: . . . * . .: 120 :EFSTAVKELADELGVVIVAGMFTPADTVQRGEKTISRVNNTVLISGAGLHQGYNKIHTYD:Sequence :HHHHHHHHHHHHHTcEEEEEEEEEETTEEEcccTTcccEEEEEEcTTccEEEEEcccccG:Sec Str :============================================================:RP:SCP|1->266|1f89A|7e-46|28.9|249/271|d.160.1.1 :============================================================:BL:SWS|1->247|Y480_MYCTU|1e-48|47.4|234/340 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|17->176|PF00795|1e-07|33.6|152/171|CN_hydrolase 121: . . + . . .: 180 :AFGYRESDTVKPGDELVVFEVDDIKFGVATCYDIRFPEQFKDLARNDAQVILVPTSWQDG:Sequence :GGTTTTTTTcccccccccEEETTEEEEEEEGGGGGcTTTTccccccccTTcccccEEccc:Sec Str : ##################### :PROS|147->167|PS01227|UPF0012|PDOC00943| :============================================================:RP:SCP|1->266|1f89A|7e-46|28.9|249/271|d.160.1.1 :============================================================:BL:SWS|1->247|Y480_MYCTU|1e-48|47.4|234/340 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|17->176|PF00795|1e-07|33.6|152/171|CN_hydrolase 181: . * . . . .: 240 :PGKLEQWQLLPRARALDSTSWIVACGQARLPEELRDKRNGPTGIGHSMVANPHGQVIVSA:Sequence :GGGHHHHHHHHHHHHHHTTcEEEEEEcEEEcTccccccTccEEEEEEEEEcTTccEEEEE:Sec Str :============================================================:RP:SCP|1->266|1f89A|7e-46|28.9|249/271|d.160.1.1 :============================================================:BL:SWS|1->247|Y480_MYCTU|1e-48|47.4|234/340 241: + . . . . *: 300 :GYEPEMLIVDIDVSDLSKIREALPVL :Sequence :EcccEEEEEEEcHHHHHHHHHHccGG :Sec Str :========================== :RP:SCP|1->266|1f89A|7e-46|28.9|249/271|d.160.1.1 :======= :BL:SWS|1->247|Y480_MYCTU|1e-48|47.4|234/340