[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF55730.1"

            "hypothetical protein"
            ""

OrgPattern --1----1-------1-1------------1-------1----11-11-------------------- -16-211-111---21111-1111121111111111211112111111111-112112--11212212341-------11---------1--------------1---1------------------------------------1--------------------------------------------1------------------1----------12-1----------11-1-----111-----1---1-------------------1--------------------------------------------------------------------------------11---------------3--2221-----1--1----1-11111111111111-11-11111112-111111111111-1-111111111-11---------112-11---------------------------1----21---11--111111---------------11-1111--222---------2------------------------11----1--------------------1--------------------------------------1--------------2----------11--------------------------------------------111----------------------------------------------------1111---------------------------------------------------------------------1---------------------111111--------2--------------------------------------1- ----111-------11-1-11-1---1------1111111111-------2131--------2--1211--1211----11121-1-1-221--1-12122------1-29-22223-1---2-11-12992-331-1--2-22--2-2-2--12-1221-2-1312412-14-2-1--------1--1-----1221- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTLYDETLTLLQELIRNACVNDLTPDSGQEIRNAESLERFFEGTPNVEITKLEPRPGRTS:Sequence : HTHHHHHHHHHHHHTccccccccHHHHHHHHHHHHHHHHHHHEEEcccEEEccEEEccc:Sec Str : ========================================================:RP:SCP|5->314|1q7l.1|5e-18|19.0|258/280|c.56.5.4 : ====:BL:SWS|57->437|P20D1_XENTR|5e-24|29.6|368/512 61: . . . * . .: 120 :IIVTVPGSDPNAEPLTLLGHTDVVPVDLPKWTKDPFGAEISDGQIWGRGSVDMLFITATQ:Sequence :EEEEEEcccTTccEEEEEEEccccccGGGTccccTTccEEETTEEEcTTTTTHHHHHHHH:Sec Str : XXXX:SEG|117->129|tatqaavtrqvar :============================================================:RP:SCP|5->314|1q7l.1|5e-18|19.0|258/280|c.56.5.4 :============================================================:BL:SWS|57->437|P20D1_XENTR|5e-24|29.6|368/512 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|77->112|PF01546|1e-05|52.8|36/308|Peptidase_M20 121: . . + . . .: 180 :AAVTRQVAREGGLRGTLTFVGVADEEARGGLGAKWLSEEHQNLFSWKNCLSESGGSHLPV:Sequence :HHHHHHHHTTcccccEEEEEEEccGGGTcTTHHHHHHHTTTTTTTTccEEEEccccccEc:Sec Str :XXXXXXXXX :SEG|117->129|tatqaavtrqvar :============================================================:RP:SCP|5->314|1q7l.1|5e-18|19.0|258/280|c.56.5.4 :============================================================:BL:SWS|57->437|P20D1_XENTR|5e-24|29.6|368/512 181: . * . . . .: 240 :HDGSDAVVINVGEKGAAQRRIHVNGDAGHGSIPFDRDSAIVKIGEVARRIAAADLKVAKD:Sequence :cccccEEEEEEcEEEEEEEEEEcccccEETTTTTccccHHHHHHHHHTTcccTTcccccT:Sec Str :============================================================:RP:SCP|5->314|1q7l.1|5e-18|19.0|258/280|c.56.5.4 :============================================================:BL:SWS|57->437|P20D1_XENTR|5e-24|29.6|368/512 241: + . . . . *: 300 :DIWQGFVQAHRFDPETEQALLSGTSPEAYAEFGGLSRFAHAVSHLTIAQTVVRAGQAINV:Sequence :TTTTTcccccHccHHHHHHHHTccccccccHHHHHHHHTccEEEEEEEEccccccccccE:Sec Str :============================================================:RP:SCP|5->314|1q7l.1|5e-18|19.0|258/280|c.56.5.4 : ==:RP:SCP|299->351|1xmbA2|8e-04|13.2|53/102|d.58.19.1 :============================================================:BL:SWS|57->437|P20D1_XENTR|5e-24|29.6|368/512 301: . . . . + .: 360 :LPSHAYLELDIRTLPGQTNDYVDDTLRGALGDLADEVEIEHLISEEATVSPTDSRLYNTL:Sequence :EccEEEEEEEEEEcTTccHHHHHHHHHHHHHHHHHEEEEEEEEEEccEEcccccGGGHHH:Sec Str :============== :RP:SCP|5->314|1q7l.1|5e-18|19.0|258/280|c.56.5.4 :=================================================== :RP:SCP|299->351|1xmbA2|8e-04|13.2|53/102|d.58.19.1 :============================================================:BL:SWS|57->437|P20D1_XENTR|5e-24|29.6|368/512 361: . . . * . .: 420 :EKVLGDFFPDAPVVPIISSGGSDLRFGRRLGGVGYGFAVHARERTLAEAMGQLHSHDEAL:Sequence :HHHHHHHccccEcEEEEccccHHHHHHHHHHcccEEEccccTTcccccTTccTTcTTcEE:Sec Str :============================================================:BL:SWS|57->437|P20D1_XENTR|5e-24|29.6|368/512 421: . . + . . .: 480 :YLEDLELTVRGYDSVVREFLG :Sequence :EHHHHHHHHHHHHHHHHHHHc :Sec Str :================= :BL:SWS|57->437|P20D1_XENTR|5e-24|29.6|368/512