[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cglu2:BAF55908.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ------11111-1-221----2---2------222221221111211-122112211-111--11112311-111111------------1---11-----1---22-1---------------------------111-2-----121111111-------1---2222-------------111-----11222222222222222211--11222-11-111--------111111111111111111112----------1111--------11----111111111111111111111111111111111----111-----------------------------------------------------1-------------1------1-11111111111-------11--1--11-----------11-2------11------------11-2----------------------------------1------111111111111111111111-111111--11----------------1-11-----------1--1-----------------------11112--------------------------------2211-3121-1111---1111-1--1---------------11-11111111111111-1111111111111111111111111-11111111111111111211111111-111111111111---1-----------11-1111-11-----11-------11111-11111111111111111---------1--------------11111111111111----------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MANYTVPGINENDAKQLIDGLQERLTDYNDLHLILKHVHWNVTGPNFIAVHEMLDPQVDL:Sequence :ccccccccccHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccTTHHHHHHHHHHHHHH:Sec Str : ################# :PROS|39->55|PS00818|DPS_1|PDOC00645| : ==================================================:RP:SCP|11->156|2fjcA1|3e-36|21.9|146/151|a.25.1.1 :============================================================:BL:SWS|1->163|DPS_MYCSM|8e-49|53.4|163/183 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|18->156|PF00210|6e-09|28.5|137/141|Ferritin 61: . . . * . .: 120 :VRGYADEVAERISTLGGAPVGTPEGHVADRTPLQYERNAGNAQAHLTDLNRVYTQVLTGV:Sequence :HHHHHHHHHHHHHHTTccccccHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|11->156|2fjcA1|3e-36|21.9|146/151|a.25.1.1 :============================================================:BL:SWS|1->163|DPS_MYCSM|8e-49|53.4|163/183 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|18->156|PF00210|6e-09|28.5|137/141|Ferritin 121: . . + . . .: 180 :RESMASAGPVDPVTEDIYIGQAAELEKFQWFIRAHIVDVDGNIQE :Sequence :HHHHHHHHHTcHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHT :Sec Str :==================================== :RP:SCP|11->156|2fjcA1|3e-36|21.9|146/151|a.25.1.1 :=========================================== :BL:SWS|1->163|DPS_MYCSM|8e-49|53.4|163/183 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|18->156|PF00210|6e-09|28.5|137/141|Ferritin