[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "cimm2:CIRG_00317"

            ""
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------111111------------------------------------------------------------------------------------------------------------------------------------------------------------ -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNIPCVLCTMHTFPRNLDHVPEAFVPRVKELLDLSAEREKNGQGMLRRIIDAEIQRKAKE:Sequence : ===================================================:BL:SWS|10->154|PPIP2_MOUSE|9e-04|26.8|127/100 61: . . . * . .: 120 :FQNKYGAYVKDLKKKNAEEKDKCNPYNTRSKAAAGPAVEGVKTGPSSNIANDALMERFCT:Sequence :============================================================:BL:SWS|10->154|PPIP2_MOUSE|9e-04|26.8|127/100 121: . . + . . .: 180 :ALEDTRRTLEGIEKGLNKIVSILEKAKVDVSIVHDRKRERSPIRTPSGTEKPPPRCVQDS:Sequence :================================== :BL:SWS|10->154|PPIP2_MOUSE|9e-04|26.8|127/100 181: . * . . . .: 240 :PA :Sequence